Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 265701..266099 | Replicon | chromosome |
| Accession | NZ_CP106757 | ||
| Organism | Enterococcus faecalis strain NY13410 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | N8I78_RS01270 | Protein ID | WP_021164545.1 |
| Coordinates | 265701..265805 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 265945..266099 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I78_RS01260 | 261016..261159 | - | 144 | WP_002387585.1 | putative holin-like toxin | - |
| N8I78_RS01265 | 261753..265511 | + | 3759 | WP_010706868.1 | WxL domain-containing protein | - |
| N8I78_RS01270 | 265701..265805 | - | 105 | WP_021164545.1 | putative holin-like toxin | Toxin |
| - | 265945..266099 | + | 155 | - | - | Antitoxin |
| N8I78_RS01275 | 266407..268023 | - | 1617 | WP_002379014.1 | phosphatase PAP2/LCP family protein | - |
| N8I78_RS01280 | 268485..269780 | + | 1296 | WP_002379013.1 | ATP-binding protein | - |
| N8I78_RS01285 | 269789..270421 | + | 633 | WP_002358972.1 | RloB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3813.70 Da Isoelectric Point: 10.3686
>T259734 WP_021164545.1 NZ_CP106757:c265805-265701 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 105 bp
Antitoxin
Download Length: 155 bp
>AT259734 NZ_CP106757:265945-266099 [Enterococcus faecalis]
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
TTTTTAGGTAAGTGTGCTATAATAGCAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|