Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4199558..4200285 | Replicon | chromosome |
Accession | NZ_CP106756 | ||
Organism | Escherichia coli strain B-JRPT-4119 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | N8153_RS20380 | Protein ID | WP_000550189.1 |
Coordinates | 4199971..4200285 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N8153_RS20375 | Protein ID | WP_000560266.1 |
Coordinates | 4199558..4199974 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8153_RS20365 (4194718) | 4194718..4197069 | + | 2352 | WP_000695486.1 | alpha-glucosidase | - |
N8153_RS20370 (4197495) | 4197495..4199513 | + | 2019 | WP_000121449.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
N8153_RS20375 (4199558) | 4199558..4199974 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
N8153_RS20380 (4199971) | 4199971..4200285 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
N8153_RS20385 (4200569) | 4200569..4201705 | - | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
N8153_RS20390 (4201790) | 4201790..4202293 | + | 504 | WP_001300832.1 | M48 family metallopeptidase | - |
N8153_RS20395 (4202370) | 4202370..4203062 | + | 693 | WP_000942546.1 | vancomycin high temperature exclusion protein | - |
N8153_RS20400 (4203141) | 4203141..4204127 | + | 987 | WP_001301393.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T259726 WP_000550189.1 NZ_CP106756:c4200285-4199971 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT259726 WP_000560266.1 NZ_CP106756:c4199974-4199558 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|