Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1198313..1199007 | Replicon | chromosome |
| Accession | NZ_CP106756 | ||
| Organism | Escherichia coli strain B-JRPT-4119 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1EXB8 |
| Locus tag | N8153_RS05700 | Protein ID | WP_001263493.1 |
| Coordinates | 1198609..1199007 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1FJN6 |
| Locus tag | N8153_RS05695 | Protein ID | WP_000554757.1 |
| Coordinates | 1198313..1198606 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8153_RS05675 (1193953) | 1193953..1194450 | + | 498 | WP_000006260.1 | REP-associated tyrosine transposase RayT | - |
| N8153_RS05680 (1194666) | 1194666..1196378 | - | 1713 | Protein_1092 | flagellar biosynthesis protein FlhA | - |
| N8153_RS05685 (1196350) | 1196350..1197135 | + | 786 | WP_000207564.1 | putative lateral flagellar export/assembly protein LafU | - |
| N8153_RS05690 (1197206) | 1197206..1198261 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| N8153_RS05695 (1198313) | 1198313..1198606 | + | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| N8153_RS05700 (1198609) | 1198609..1199007 | + | 399 | WP_001263493.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| N8153_RS05705 (1199017) | 1199017..1199469 | + | 453 | WP_001059847.1 | GNAT family N-acetyltransferase | - |
| N8153_RS05710 (1199715) | 1199715..1199918 | + | 204 | Protein_1098 | RtcB family protein | - |
| N8153_RS05715 (1199917) | 1199917..1200438 | + | 522 | Protein_1099 | peptide chain release factor H | - |
| N8153_RS05720 (1200495) | 1200495..1201952 | - | 1458 | WP_001293003.1 | cytosol nonspecific dipeptidase | - |
| N8153_RS05725 (1202213) | 1202213..1202671 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (1203267) | 1203267..1203347 | + | 81 | NuclAT_12 | - | - |
| - (1203267) | 1203267..1203347 | + | 81 | NuclAT_12 | - | - |
| - (1203267) | 1203267..1203347 | + | 81 | NuclAT_12 | - | - |
| - (1203267) | 1203267..1203347 | + | 81 | NuclAT_12 | - | - |
| N8153_RS05730 (1202763) | 1202763..1204007 | + | 1245 | WP_000189541.1 | esterase FrsA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15472.83 Da Isoelectric Point: 8.0949
>T259712 WP_001263493.1 NZ_CP106756:1198609-1199007 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|