Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3452148..3452814 | Replicon | chromosome |
| Accession | NZ_CP106754 | ||
| Organism | Kosakonia sp. ML.JS2a | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N7922_RS16405 | Protein ID | WP_263097340.1 |
| Coordinates | 3452512..3452814 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7922_RS16400 | Protein ID | WP_263097339.1 |
| Coordinates | 3452148..3452489 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7922_RS16365 (N7922_16365) | 3447169..3447492 | - | 324 | WP_263097329.1 | heavy metal-binding domain-containing protein | - |
| N7922_RS16370 (N7922_16370) | 3447595..3448110 | + | 516 | WP_263097331.1 | lipoprotein | - |
| N7922_RS16375 (N7922_16375) | 3448320..3449048 | + | 729 | WP_263097332.1 | arginine ABC transporter ATP-binding protein ArtP | - |
| N7922_RS16380 (N7922_16380) | 3449068..3449799 | + | 732 | WP_263097334.1 | arginine ABC transporter substrate-binding protein ArtI | - |
| N7922_RS16385 (N7922_16385) | 3449806..3450522 | + | 717 | WP_263097335.1 | arginine ABC transporter permease ArtQ | - |
| N7922_RS16390 (N7922_16390) | 3450522..3451190 | + | 669 | WP_263097336.1 | arginine ABC transporter permease ArtM | - |
| N7922_RS16395 (N7922_16395) | 3451360..3452091 | + | 732 | WP_263097338.1 | arginine ABC transporter substrate-binding protein ArtJ | - |
| N7922_RS16400 (N7922_16400) | 3452148..3452489 | - | 342 | WP_263097339.1 | HigA family addiction module antitoxin | Antitoxin |
| N7922_RS16405 (N7922_16405) | 3452512..3452814 | - | 303 | WP_263097340.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7922_RS16410 (N7922_16410) | 3452885..3454012 | - | 1128 | WP_263097341.1 | 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC | - |
| N7922_RS16415 (N7922_16415) | 3454054..3454524 | - | 471 | WP_263097343.1 | YbjO family protein | - |
| N7922_RS16420 (N7922_16420) | 3454599..3455444 | - | 846 | WP_061494631.1 | putrescine ABC transporter permease PotI | - |
| N7922_RS16425 (N7922_16425) | 3455441..3456394 | - | 954 | WP_263100932.1 | putrescine ABC transporter permease PotH | - |
| N7922_RS16430 (N7922_16430) | 3456404..3457537 | - | 1134 | WP_263097344.1 | putrescine ABC transporter ATP-binding subunit PotG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11667.52 Da Isoelectric Point: 10.1295
>T259704 WP_263097340.1 NZ_CP106754:c3452814-3452512 [Kosakonia sp. ML.JS2a]
MPKKISIGCFRDPWLEAFFHHAALHRKIPVDIHTALSRKLDIINAAASHRDLRSPPGNRYEELLGKLQGYSSIRVNKQYR
LIFKWVNGKAEDLYLDPHIY
MPKKISIGCFRDPWLEAFFHHAALHRKIPVDIHTALSRKLDIINAAASHRDLRSPPGNRYEELLGKLQGYSSIRVNKQYR
LIFKWVNGKAEDLYLDPHIY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|