Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HTH_XRE
Location 3452148..3452814 Replicon chromosome
Accession NZ_CP106754
Organism Kosakonia sp. ML.JS2a

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag N7922_RS16405 Protein ID WP_263097340.1
Coordinates 3452512..3452814 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N7922_RS16400 Protein ID WP_263097339.1
Coordinates 3452148..3452489 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7922_RS16365 (N7922_16365) 3447169..3447492 - 324 WP_263097329.1 heavy metal-binding domain-containing protein -
N7922_RS16370 (N7922_16370) 3447595..3448110 + 516 WP_263097331.1 lipoprotein -
N7922_RS16375 (N7922_16375) 3448320..3449048 + 729 WP_263097332.1 arginine ABC transporter ATP-binding protein ArtP -
N7922_RS16380 (N7922_16380) 3449068..3449799 + 732 WP_263097334.1 arginine ABC transporter substrate-binding protein ArtI -
N7922_RS16385 (N7922_16385) 3449806..3450522 + 717 WP_263097335.1 arginine ABC transporter permease ArtQ -
N7922_RS16390 (N7922_16390) 3450522..3451190 + 669 WP_263097336.1 arginine ABC transporter permease ArtM -
N7922_RS16395 (N7922_16395) 3451360..3452091 + 732 WP_263097338.1 arginine ABC transporter substrate-binding protein ArtJ -
N7922_RS16400 (N7922_16400) 3452148..3452489 - 342 WP_263097339.1 HigA family addiction module antitoxin Antitoxin
N7922_RS16405 (N7922_16405) 3452512..3452814 - 303 WP_263097340.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7922_RS16410 (N7922_16410) 3452885..3454012 - 1128 WP_263097341.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
N7922_RS16415 (N7922_16415) 3454054..3454524 - 471 WP_263097343.1 YbjO family protein -
N7922_RS16420 (N7922_16420) 3454599..3455444 - 846 WP_061494631.1 putrescine ABC transporter permease PotI -
N7922_RS16425 (N7922_16425) 3455441..3456394 - 954 WP_263100932.1 putrescine ABC transporter permease PotH -
N7922_RS16430 (N7922_16430) 3456404..3457537 - 1134 WP_263097344.1 putrescine ABC transporter ATP-binding subunit PotG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(10-98)

Antitoxin

Cro/C1-type helix-turn-helix domain

(16-70)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11667.52 Da        Isoelectric Point: 10.1295

>T259704 WP_263097340.1 NZ_CP106754:c3452814-3452512 [Kosakonia sp. ML.JS2a]
MPKKISIGCFRDPWLEAFFHHAALHRKIPVDIHTALSRKLDIINAAASHRDLRSPPGNRYEELLGKLQGYSSIRVNKQYR
LIFKWVNGKAEDLYLDPHIY

Download         Length: 303 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12956.71 Da        Isoelectric Point: 4.9209

>AT259704 WP_263097339.1 NZ_CP106754:c3452489-3452148 [Kosakonia sp. ML.JS2a]
MTPASRKPTTVGDILLYEYLEPLDLRINELAEMLHVHRNSVSALVNNNRRLTTDMAFRLARVFDTSVDFWINLQAAVDLW
DVENDTRVQEELSRIEPAAEFIARREAGSKKVA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References