Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1965015..1965660 | Replicon | chromosome |
Accession | NZ_CP106754 | ||
Organism | Kosakonia sp. ML.JS2a |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N7922_RS09400 | Protein ID | WP_263100280.1 |
Coordinates | 1965015..1965332 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N7922_RS09405 | Protein ID | WP_263100281.1 |
Coordinates | 1965358..1965660 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7922_RS09380 (N7922_09380) | 1960298..1961038 | + | 741 | WP_263100276.1 | adenosylcobinamide-GDP ribazoletransferase | - |
N7922_RS09385 (N7922_09385) | 1961066..1962124 | + | 1059 | WP_263100277.1 | nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase | - |
N7922_RS09390 (N7922_09390) | 1962128..1962439 | - | 312 | WP_263100278.1 | helix-turn-helix domain-containing protein | - |
N7922_RS09395 (N7922_09395) | 1962678..1964780 | + | 2103 | WP_263100279.1 | elongation factor G | - |
N7922_RS09400 (N7922_09400) | 1965015..1965332 | + | 318 | WP_263100280.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7922_RS09405 (N7922_09405) | 1965358..1965660 | + | 303 | WP_263100281.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N7922_RS09410 (N7922_09410) | 1965745..1966698 | + | 954 | WP_263100283.1 | L,D-transpeptidase | - |
N7922_RS09415 (N7922_09415) | 1966757..1967068 | - | 312 | WP_263100284.1 | hypothetical protein | - |
N7922_RS09420 (N7922_09420) | 1967106..1967561 | - | 456 | WP_263100285.1 | hypothetical protein | - |
N7922_RS09425 (N7922_09425) | 1968012..1969442 | + | 1431 | WP_263100287.1 | efflux transporter outer membrane subunit | - |
N7922_RS09430 (N7922_09430) | 1969439..1969669 | + | 231 | Protein_1849 | GNAT family N-acetyltransferase | - |
N7922_RS09435 (N7922_09435) | 1969802..1970572 | - | 771 | WP_263100288.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12066.93 Da Isoelectric Point: 10.6042
>T259698 WP_263100280.1 NZ_CP106754:1965015-1965332 [Kosakonia sp. ML.JS2a]
MTKTFDNWFSTLGERDRASVLAALMVLREKGPALPRPWADTVKGSRYSNMKELRVQSRGDPLRVFFAFDPQRVGILLCAG
SKAGHEKRFYDVMIPTADREFRHHL
MTKTFDNWFSTLGERDRASVLAALMVLREKGPALPRPWADTVKGSRYSNMKELRVQSRGDPLRVFFAFDPQRVGILLCAG
SKAGHEKRFYDVMIPTADREFRHHL
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|