Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 1522849..1523449 | Replicon | chromosome |
| Accession | NZ_CP106754 | ||
| Organism | Kosakonia sp. ML.JS2a | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N7922_RS07420 | Protein ID | WP_263099919.1 |
| Coordinates | 1522849..1523175 (+) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7922_RS07425 | Protein ID | WP_263100854.1 |
| Coordinates | 1523210..1523449 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7922_RS07390 (N7922_07390) | 1518067..1518840 | + | 774 | WP_263099914.1 | amino acid ABC transporter permease | - |
| N7922_RS07395 (N7922_07395) | 1518846..1519571 | + | 726 | WP_263100853.1 | amino acid ABC transporter ATP-binding protein | - |
| N7922_RS07400 (N7922_07400) | 1519597..1520340 | - | 744 | WP_263099915.1 | GGDEF domain-containing protein | - |
| N7922_RS07405 (N7922_07405) | 1520334..1520750 | - | 417 | WP_263099916.1 | DUF1987 domain-containing protein | - |
| N7922_RS07410 (N7922_07410) | 1520743..1521324 | - | 582 | WP_263099917.1 | SiaB family protein kinase | - |
| N7922_RS07415 (N7922_07415) | 1521333..1522541 | - | 1209 | WP_263099918.1 | SpoIIE family protein phosphatase | - |
| N7922_RS07420 (N7922_07420) | 1522849..1523175 | + | 327 | WP_263099919.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7922_RS07425 (N7922_07425) | 1523210..1523449 | + | 240 | WP_263100854.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N7922_RS07430 (N7922_07430) | 1523625..1524647 | - | 1023 | WP_263099920.1 | malate/lactate/ureidoglycolate dehydrogenase | - |
| N7922_RS07435 (N7922_07435) | 1524875..1525882 | + | 1008 | WP_263099921.1 | ABC transporter substrate-binding protein | - |
| N7922_RS07440 (N7922_07440) | 1525904..1526746 | + | 843 | WP_263099922.1 | ABC transporter ATP-binding protein | - |
| N7922_RS07445 (N7922_07445) | 1526718..1527584 | + | 867 | WP_263099923.1 | ABC transporter permease | - |
| N7922_RS07450 (N7922_07450) | 1527773..1528159 | + | 387 | WP_263099924.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12253.56 Da Isoelectric Point: 9.6082
>T259697 WP_263099919.1 NZ_CP106754:1522849-1523175 [Kosakonia sp. ML.JS2a]
VFNVILHEDVPAEIACLSPVIRAKLIRLIDKLQANATTLREPDSRHLCNGLFEIRTMGIDIARGLYAYQKGKRIYLLRVF
IKKTQKTPSGEIALAFARLEEMLACEKI
VFNVILHEDVPAEIACLSPVIRAKLIRLIDKLQANATTLREPDSRHLCNGLFEIRTMGIDIARGLYAYQKGKRIYLLRVF
IKKTQKTPSGEIALAFARLEEMLACEKI
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|