Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1522849..1523449 Replicon chromosome
Accession NZ_CP106754
Organism Kosakonia sp. ML.JS2a

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag N7922_RS07420 Protein ID WP_263099919.1
Coordinates 1522849..1523175 (+) Length 109 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag N7922_RS07425 Protein ID WP_263100854.1
Coordinates 1523210..1523449 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7922_RS07390 (N7922_07390) 1518067..1518840 + 774 WP_263099914.1 amino acid ABC transporter permease -
N7922_RS07395 (N7922_07395) 1518846..1519571 + 726 WP_263100853.1 amino acid ABC transporter ATP-binding protein -
N7922_RS07400 (N7922_07400) 1519597..1520340 - 744 WP_263099915.1 GGDEF domain-containing protein -
N7922_RS07405 (N7922_07405) 1520334..1520750 - 417 WP_263099916.1 DUF1987 domain-containing protein -
N7922_RS07410 (N7922_07410) 1520743..1521324 - 582 WP_263099917.1 SiaB family protein kinase -
N7922_RS07415 (N7922_07415) 1521333..1522541 - 1209 WP_263099918.1 SpoIIE family protein phosphatase -
N7922_RS07420 (N7922_07420) 1522849..1523175 + 327 WP_263099919.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7922_RS07425 (N7922_07425) 1523210..1523449 + 240 WP_263100854.1 helix-turn-helix transcriptional regulator Antitoxin
N7922_RS07430 (N7922_07430) 1523625..1524647 - 1023 WP_263099920.1 malate/lactate/ureidoglycolate dehydrogenase -
N7922_RS07435 (N7922_07435) 1524875..1525882 + 1008 WP_263099921.1 ABC transporter substrate-binding protein -
N7922_RS07440 (N7922_07440) 1525904..1526746 + 843 WP_263099922.1 ABC transporter ATP-binding protein -
N7922_RS07445 (N7922_07445) 1526718..1527584 + 867 WP_263099923.1 ABC transporter permease -
N7922_RS07450 (N7922_07450) 1527773..1528159 + 387 WP_263099924.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(13-100)

Antitoxin

Cro/C1-type helix-turn-helix domain

(22-72)


Sequences

Toxin        


Download         Length: 109 a.a.        Molecular weight: 12253.56 Da        Isoelectric Point: 9.6082

>T259697 WP_263099919.1 NZ_CP106754:1522849-1523175 [Kosakonia sp. ML.JS2a]
VFNVILHEDVPAEIACLSPVIRAKLIRLIDKLQANATTLREPDSRHLCNGLFEIRTMGIDIARGLYAYQKGKRIYLLRVF
IKKTQKTPSGEIALAFARLEEMLACEKI

Download         Length: 327 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8879.29 Da        Isoelectric Point: 9.8529

>AT259697 WP_263100854.1 NZ_CP106754:1523210-1523449 [Kosakonia sp. ML.JS2a]
MSDPDVQAAYEAEERKMRLQAMLAEWRRHAGLTRAQVAERMGVTPPTVSRMEANVIKASLETLARYARACGIKHPQITL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References