Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1474563..1475164 | Replicon | chromosome |
| Accession | NZ_CP106753 | ||
| Organism | Chitiniphilus sp. CD1 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | N8I74_RS06745 | Protein ID | WP_263126101.1 |
| Coordinates | 1474886..1475164 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N8I74_RS06740 | Protein ID | WP_263126100.1 |
| Coordinates | 1474563..1474874 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8I74_RS06700 (N8I74_06700) | 1469578..1470078 | + | 501 | WP_263126090.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| N8I74_RS06705 (N8I74_06705) | 1470057..1470509 | + | 453 | WP_263126091.1 | hypothetical protein | - |
| N8I74_RS06710 (N8I74_06710) | 1470556..1470732 | + | 177 | WP_263126092.1 | hypothetical protein | - |
| N8I74_RS06715 (N8I74_06715) | 1470895..1472241 | + | 1347 | WP_263126093.1 | hypothetical protein | - |
| N8I74_RS06720 (N8I74_06720) | 1472281..1472553 | + | 273 | WP_263126094.1 | hypothetical protein | - |
| N8I74_RS06725 (N8I74_06725) | 1472550..1473359 | + | 810 | WP_263126095.1 | hypothetical protein | - |
| N8I74_RS06730 (N8I74_06730) | 1473401..1473922 | + | 522 | WP_263126097.1 | hypothetical protein | - |
| N8I74_RS06735 (N8I74_06735) | 1474089..1474490 | + | 402 | WP_263126098.1 | hypothetical protein | - |
| N8I74_RS06740 (N8I74_06740) | 1474563..1474874 | - | 312 | WP_263126100.1 | HigA family addiction module antitoxin | Antitoxin |
| N8I74_RS06745 (N8I74_06745) | 1474886..1475164 | - | 279 | WP_263126101.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8I74_RS06750 (N8I74_06750) | 1475219..1476262 | - | 1044 | WP_263126102.1 | phage late control D family protein | - |
| N8I74_RS06755 (N8I74_06755) | 1476259..1476684 | - | 426 | WP_263126103.1 | phage tail protein | - |
| N8I74_RS06760 (N8I74_06760) | 1476696..1479833 | - | 3138 | WP_263126104.1 | phage tail tape measure protein | - |
| N8I74_RS06765 (N8I74_06765) | 1479790..1479966 | - | 177 | WP_263126105.1 | hypothetical protein | - |
| N8I74_RS06770 (N8I74_06770) | 1480033..1480152 | - | 120 | WP_263126106.1 | GpE family phage tail protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1460004..1501968 | 41964 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10298.62 Da Isoelectric Point: 8.1004
>T259693 WP_263126101.1 NZ_CP106753:c1475164-1474886 [Chitiniphilus sp. CD1]
MIRSFADQATADLFAGKRVARFANIASVATRKLQQLDSAATLNALRAPPGNRLEQLHGDRAGQHSIRINDQWRVCFVWTA
EGVEHVEIVDYH
MIRSFADQATADLFAGKRVARFANIASVATRKLQQLDSAATLNALRAPPGNRLEQLHGDRAGQHSIRINDQWRVCFVWTA
EGVEHVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|