Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 897630..898281 | Replicon | chromosome |
Accession | NZ_CP106752 | ||
Organism | Psychrobacter sp. SC65A.3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OEG80_RS03920 | Protein ID | WP_263241852.1 |
Coordinates | 897934..898281 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A197ET80 |
Locus tag | OEG80_RS03915 | Protein ID | WP_068408813.1 |
Coordinates | 897630..897932 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG80_RS03890 (SC65A3_00791) | 893058..894227 | - | 1170 | WP_263241846.1 | CynX/NimT family MFS transporter | - |
OEG80_RS03895 (SC65A3_00792) | 894398..894868 | - | 471 | WP_020443882.1 | cyanase | - |
OEG80_RS03900 (SC65A3_00793) | 894992..895651 | - | 660 | WP_263241847.1 | carbonic anhydrase | - |
OEG80_RS03905 (SC65A3_00794) | 895844..896725 | + | 882 | WP_263241848.1 | transcriptional regulator CynR | - |
OEG80_RS03910 (SC65A3_00795) | 897116..897409 | + | 294 | WP_020443287.1 | hypothetical protein | - |
OEG80_RS03915 (SC65A3_00796) | 897630..897932 | - | 303 | WP_068408813.1 | XRE family transcriptional regulator | Antitoxin |
OEG80_RS03920 (SC65A3_00797) | 897934..898281 | - | 348 | WP_263241852.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEG80_RS03925 (SC65A3_00798) | 898548..898784 | + | 237 | WP_263241854.1 | hypothetical protein | - |
OEG80_RS03930 (SC65A3_00799) | 898845..899477 | - | 633 | WP_263241855.1 | recombinase family protein | - |
OEG80_RS03935 (SC65A3_00802) | 900011..901176 | + | 1166 | WP_263241287.1 | IS3 family transposase | - |
OEG80_RS03940 (SC65A3_00803) | 901219..901443 | - | 225 | WP_263241857.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 895844..911762 | 15918 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13383.37 Da Isoelectric Point: 7.8524
>T259691 WP_263241852.1 NZ_CP106752:c898281-897934 [Psychrobacter sp. SC65A.3]
MWTVITTELFNQWFDQQDDSTQEKVLAALMVLEQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPKRQAI
VLCIGDKGNKKRFYKEMLATADQQYECHLRTLGDP
MWTVITTELFNQWFDQQDDSTQEKVLAALMVLEQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPKRQAI
VLCIGDKGNKKRFYKEMLATADQQYECHLRTLGDP
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|