Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5149996..5150591 | Replicon | chromosome |
| Accession | NZ_CP106745 | ||
| Organism | Pseudomonas aeruginosa strain PALA17 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PALA17_RS24160 | Protein ID | WP_071538299.1 |
| Coordinates | 5150313..5150591 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA17_RS24155 | Protein ID | WP_003123432.1 |
| Coordinates | 5149996..5150301 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA17_RS24120 (PALA17_04792) | 5145136..5145984 | + | 849 | WP_003123430.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PALA17_RS24130 (PALA17_04794) | 5146151..5147092 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA17_RS24135 (PALA17_04795) | 5147209..5147823 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA17_RS24140 (PALA17_04796) | 5147865..5148449 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA17_RS24145 (PALA17_04797) | 5148490..5149590 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA17_RS24155 (PALA17_04799) | 5149996..5150301 | - | 306 | WP_003123432.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA17_RS24160 | 5150313..5150591 | - | 279 | WP_071538299.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA17_RS24165 | 5150644..5150772 | - | 129 | Protein_4771 | integrase | - |
| PALA17_RS24170 (PALA17_04800) | 5150920..5153148 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| PALA17_RS24175 (PALA17_04801) | 5153218..5153865 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA17_RS24180 (PALA17_04802) | 5153927..5155165 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10616.17 Da Isoelectric Point: 7.8937
>T259687 WP_071538299.1 NZ_CP106745:c5150591-5150313 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHGIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|