Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3753532..3754114 | Replicon | chromosome |
Accession | NZ_CP106744 | ||
Organism | Pseudomonas aeruginosa strain PALA16 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PALA16_RS17400 | Protein ID | WP_176601308.1 |
Coordinates | 3753532..3753843 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA16_RS17405 | Protein ID | WP_176601309.1 |
Coordinates | 3753836..3754114 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA16_RS17355 (PALA16_03442) | 3748860..3749093 | - | 234 | WP_003450286.1 | hypothetical protein | - |
PALA16_RS17360 (PALA16_03443) | 3749278..3749778 | + | 501 | WP_003139775.1 | hypothetical protein | - |
PALA16_RS17365 (PALA16_03444) | 3749799..3750170 | - | 372 | WP_003139776.1 | 5-carboxymethyl-2-hydroxymuconate isomerase | - |
PALA16_RS17370 (PALA16_03445) | 3750453..3750788 | - | 336 | WP_003119150.1 | hypothetical protein | - |
PALA16_RS17375 (PALA16_03446) | 3751225..3751488 | - | 264 | WP_034027332.1 | hypothetical protein | - |
PALA16_RS17380 (PALA16_03447) | 3751524..3751790 | - | 267 | WP_034027340.1 | hypothetical protein | - |
PALA16_RS17385 (PALA16_03448) | 3751859..3752239 | - | 381 | WP_003116780.1 | hypothetical protein | - |
PALA16_RS17390 (PALA16_03449) | 3752236..3752865 | - | 630 | WP_176601306.1 | glycoside hydrolase family 19 protein | - |
PALA16_RS17395 | 3752924..3753316 | - | 393 | WP_176601307.1 | hypothetical protein | - |
PALA16_RS17400 | 3753532..3753843 | + | 312 | WP_176601308.1 | transcriptional regulator | Toxin |
PALA16_RS17405 | 3753836..3754114 | + | 279 | WP_176601309.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA16_RS17410 (PALA16_03450) | 3754310..3756301 | - | 1992 | WP_176601311.1 | SGNH/GDSL hydrolase family protein | - |
PALA16_RS17415 (PALA16_03451) | 3756362..3759091 | - | 2730 | WP_269972823.1 | host specificity factor TipJ family phage tail protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3751225..3812938 | 61713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11566.24 Da Isoelectric Point: 9.4368
>T259675 WP_176601308.1 NZ_CP106744:3753532-3753843 [Pseudomonas aeruginosa]
MRTVIETEIFKRYADDIWSDPEREEFIAWIAANSLAGDVIPGSGGLRKVRWSRPGMGKRGGARVIYYNAEEAQAIWLLIA
YTKSKFDNLPASTLSKLKEAMNG
MRTVIETEIFKRYADDIWSDPEREEFIAWIAANSLAGDVIPGSGGLRKVRWSRPGMGKRGGARVIYYNAEEAQAIWLLIA
YTKSKFDNLPASTLSKLKEAMNG
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|