Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1593004..1593599 | Replicon | chromosome |
Accession | NZ_CP106742 | ||
Organism | Pseudomonas aeruginosa strain PALA14 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA14_RS07375 | Protein ID | WP_003117425.1 |
Coordinates | 1593004..1593282 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA14_RS07380 | Protein ID | WP_003099268.1 |
Coordinates | 1593294..1593599 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA14_RS07355 (PALA14_01453) | 1588430..1589668 | + | 1239 | WP_003113524.1 | dipeptidase | - |
PALA14_RS07360 (PALA14_01454) | 1589730..1590377 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA14_RS07365 (PALA14_01455) | 1590447..1592675 | - | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
PALA14_RS07370 | 1592823..1592951 | + | 129 | Protein_1452 | integrase | - |
PALA14_RS07375 | 1593004..1593282 | + | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA14_RS07380 (PALA14_01456) | 1593294..1593599 | + | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA14_RS07390 (PALA14_01458) | 1594006..1595106 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA14_RS07395 (PALA14_01459) | 1595147..1595731 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA14_RS07400 (PALA14_01460) | 1595774..1596388 | - | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA14_RS07405 (PALA14_01461) | 1596505..1597446 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA14_RS07415 (PALA14_01463) | 1597613..1598461 | - | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T259659 WP_003117425.1 NZ_CP106742:1593004-1593282 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|