Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3744519..3745294 | Replicon | chromosome |
| Accession | NZ_CP106682 | ||
| Organism | Pseudomonas aeruginosa strain PALA13 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V6ADY6 |
| Locus tag | PALA13_RS17400 | Protein ID | WP_009518525.1 |
| Coordinates | 3744519..3744977 (-) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A7M2ZSF3 |
| Locus tag | PALA13_RS17405 | Protein ID | WP_023087286.1 |
| Coordinates | 3744977..3745294 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA13_RS17375 (PALA13_03455) | 3739882..3740829 | + | 948 | WP_023087291.1 | TIGR03756 family integrating conjugative element protein | - |
| PALA13_RS17380 (PALA13_03456) | 3740839..3742233 | + | 1395 | WP_023087290.1 | integrating conjugative element protein | - |
| PALA13_RS17385 (PALA13_03457) | 3742230..3742589 | + | 360 | WP_023087289.1 | hypothetical protein | - |
| PALA13_RS17390 (PALA13_03458) | 3742603..3744126 | + | 1524 | WP_023087288.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PALA13_RS17395 (PALA13_03459) | 3744133..3744492 | - | 360 | WP_023087287.1 | DUF3742 family protein | - |
| PALA13_RS17400 (PALA13_03460) | 3744519..3744977 | - | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PALA13_RS17405 (PALA13_03461) | 3744977..3745294 | - | 318 | WP_023087286.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PALA13_RS17410 (PALA13_03462) | 3745594..3747459 | + | 1866 | WP_023087285.1 | MobH family relaxase | - |
| PALA13_RS17415 (PALA13_03463) | 3747515..3748063 | - | 549 | WP_228379159.1 | MerR family DNA-binding protein | - |
| PALA13_RS17420 | 3748082..3748516 | + | 435 | WP_078452152.1 | hypothetical protein | - |
| PALA13_RS17425 (PALA13_03464) | 3748671..3749072 | + | 402 | WP_023087283.1 | hypothetical protein | - |
| PALA13_RS17430 (PALA13_03465) | 3749084..3749323 | + | 240 | WP_023087282.1 | DUF2933 domain-containing protein | - |
| PALA13_RS17435 (PALA13_03466) | 3749320..3749970 | + | 651 | WP_023087281.1 | isoprenylcysteine carboxylmethyltransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3683374..3798590 | 115216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T259650 WP_009518525.1 NZ_CP106682:c3744977-3744519 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ADY6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7M2ZSF3 |