Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) prlF-yhaV (relBE)/YhaV-PrlF
Location 3744519..3745294 Replicon chromosome
Accession NZ_CP106682
Organism Pseudomonas aeruginosa strain PALA13

Toxin (Protein)


Gene name yhaV Uniprot ID V6ADY6
Locus tag PALA13_RS17400 Protein ID WP_009518525.1
Coordinates 3744519..3744977 (-) Length 153 a.a.

Antitoxin (Protein)


Gene name prlF Uniprot ID A0A7M2ZSF3
Locus tag PALA13_RS17405 Protein ID WP_023087286.1
Coordinates 3744977..3745294 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA13_RS17375 (PALA13_03455) 3739882..3740829 + 948 WP_023087291.1 TIGR03756 family integrating conjugative element protein -
PALA13_RS17380 (PALA13_03456) 3740839..3742233 + 1395 WP_023087290.1 integrating conjugative element protein -
PALA13_RS17385 (PALA13_03457) 3742230..3742589 + 360 WP_023087289.1 hypothetical protein -
PALA13_RS17390 (PALA13_03458) 3742603..3744126 + 1524 WP_023087288.1 conjugal transfer protein TraG N-terminal domain-containing protein -
PALA13_RS17395 (PALA13_03459) 3744133..3744492 - 360 WP_023087287.1 DUF3742 family protein -
PALA13_RS17400 (PALA13_03460) 3744519..3744977 - 459 WP_009518525.1 type II toxin-antitoxin system YhaV family toxin Toxin
PALA13_RS17405 (PALA13_03461) 3744977..3745294 - 318 WP_023087286.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
PALA13_RS17410 (PALA13_03462) 3745594..3747459 + 1866 WP_023087285.1 MobH family relaxase -
PALA13_RS17415 (PALA13_03463) 3747515..3748063 - 549 WP_228379159.1 MerR family DNA-binding protein -
PALA13_RS17420 3748082..3748516 + 435 WP_078452152.1 hypothetical protein -
PALA13_RS17425 (PALA13_03464) 3748671..3749072 + 402 WP_023087283.1 hypothetical protein -
PALA13_RS17430 (PALA13_03465) 3749084..3749323 + 240 WP_023087282.1 DUF2933 domain-containing protein -
PALA13_RS17435 (PALA13_03466) 3749320..3749970 + 651 WP_023087281.1 isoprenylcysteine carboxylmethyltransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 3683374..3798590 115216


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin endonuclease, YhaV

(8-144)

Antitoxin

PrlF antitoxin

(8-100)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 17660.02 Da        Isoelectric Point: 10.1848

>T259650 WP_009518525.1 NZ_CP106682:c3744977-3744519 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE

Download         Length: 459 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11156.69 Da        Isoelectric Point: 4.5685

>AT259650 WP_023087286.1 NZ_CP106682:c3745294-3744977 [Pseudomonas aeruginosa]
MPAIHEVATLTSKGQITLPKPIRQALGVDAGGKLAFDLRGSEVVVTRVDAEHEDPAIGAFLSLLARDIEAGRNLQGLPED
LARAMLEHAGHGVNLDEEIDGKVEL

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V6ADY6

Antitoxin

Source ID Structure
AlphaFold DB A0A7M2ZSF3

References