Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6653648..6654243 | Replicon | chromosome |
Accession | NZ_CP106681 | ||
Organism | Pseudomonas aeruginosa strain PALA12 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA12_RS30710 | Protein ID | WP_003117425.1 |
Coordinates | 6653648..6653926 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA12_RS30715 | Protein ID | WP_003099268.1 |
Coordinates | 6653938..6654243 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA12_RS30690 (PALA12_06082) | 6649074..6650312 | + | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
PALA12_RS30695 (PALA12_06083) | 6650374..6651021 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA12_RS30700 (PALA12_06084) | 6651091..6653319 | - | 2229 | WP_269974056.1 | TonB-dependent receptor | - |
PALA12_RS30705 | 6653467..6653595 | + | 129 | Protein_6062 | integrase | - |
PALA12_RS30710 | 6653648..6653926 | + | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA12_RS30715 (PALA12_06085) | 6653938..6654243 | + | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
PALA12_RS30720 | 6654620..6655147 | + | 528 | WP_071535723.1 | ATP-binding protein | - |
PALA12_RS30725 (PALA12_06086) | 6655159..6656697 | - | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
PALA12_RS30730 (PALA12_06087) | 6656672..6657508 | - | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
PALA12_RS30735 (PALA12_06088) | 6657640..6657906 | - | 267 | WP_016852153.1 | hypothetical protein | - |
PALA12_RS30740 (PALA12_06089) | 6658016..6658288 | + | 273 | WP_003115921.1 | hypothetical protein | - |
PALA12_RS30745 (PALA12_06090) | 6658500..6658790 | + | 291 | WP_023083237.1 | DUF5447 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T259643 WP_003117425.1 NZ_CP106681:6653648-6653926 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|