Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5304480..5305075 | Replicon | chromosome |
| Accession | NZ_CP106680 | ||
| Organism | Pseudomonas aeruginosa strain PALA11 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PALA11_RS24715 | Protein ID | WP_003117425.1 |
| Coordinates | 5304797..5305075 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA11_RS24710 | Protein ID | WP_003113527.1 |
| Coordinates | 5304480..5304785 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA11_RS24675 | 5299899..5300189 | - | 291 | WP_034030046.1 | DUF5447 family protein | - |
| PALA11_RS24680 (PALA11_04902) | 5300365..5300637 | - | 273 | WP_004352675.1 | hypothetical protein | - |
| PALA11_RS24685 (PALA11_04903) | 5300747..5301013 | + | 267 | WP_023088595.1 | hypothetical protein | - |
| PALA11_RS24690 | 5301069..5301404 | + | 336 | WP_031635219.1 | hypothetical protein | - |
| PALA11_RS24695 | 5301405..5301548 | + | 144 | Protein_4877 | DNA-binding protein | - |
| PALA11_RS24700 (PALA11_04904) | 5301739..5303544 | + | 1806 | WP_023113594.1 | NACHT domain-containing protein | - |
| PALA11_RS24705 | 5303746..5304153 | - | 408 | WP_049875498.1 | hypothetical protein | - |
| PALA11_RS24710 (PALA11_04905) | 5304480..5304785 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA11_RS24715 | 5304797..5305075 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA11_RS24720 (PALA11_04906) | 5305404..5307632 | + | 2229 | WP_031631436.1 | TonB-dependent receptor | - |
| PALA11_RS24725 (PALA11_04907) | 5307702..5308349 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA11_RS24730 (PALA11_04908) | 5308411..5309649 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T259636 WP_003117425.1 NZ_CP106680:c5305075-5304797 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|