Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4668184..4668865 | Replicon | chromosome |
Accession | NZ_CP106680 | ||
Organism | Pseudomonas aeruginosa strain PALA11 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6AKP0 |
Locus tag | PALA11_RS21765 | Protein ID | WP_003111825.1 |
Coordinates | 4668500..4668865 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A1C7BMJ2 |
Locus tag | PALA11_RS21760 | Protein ID | WP_003159602.1 |
Coordinates | 4668184..4668507 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA11_RS21725 (PALA11_04319) | 4664143..4664826 | - | 684 | WP_003116489.1 | TetR/AcrR family transcriptional regulator | - |
PALA11_RS21730 (PALA11_04320) | 4664914..4665792 | + | 879 | WP_003163191.1 | hypothetical protein | - |
PALA11_RS21740 | 4666395..4666622 | + | 228 | WP_269971960.1 | hypothetical protein | - |
PALA11_RS21745 | 4666637..4667562 | - | 926 | Protein_4301 | tyrosine-type recombinase/integrase | - |
PALA11_RS21750 (PALA11_04323) | 4667562..4667954 | - | 393 | Protein_4302 | hypothetical protein | - |
PALA11_RS21755 | 4667949..4668068 | + | 120 | Protein_4303 | IS5/IS1182 family transposase | - |
PALA11_RS21760 (PALA11_04324) | 4668184..4668507 | - | 324 | WP_003159602.1 | XRE family transcriptional regulator | Antitoxin |
PALA11_RS21765 | 4668500..4668865 | - | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA11_RS21770 | 4669156..4669330 | - | 175 | Protein_4306 | hypothetical protein | - |
PALA11_RS21775 (PALA11_04325) | 4669537..4669809 | + | 273 | WP_014603216.1 | hypothetical protein | - |
PALA11_RS21780 (PALA11_04326) | 4669839..4670264 | - | 426 | WP_003116492.1 | VOC family protein | - |
PALA11_RS21785 (PALA11_04327) | 4670365..4671249 | + | 885 | WP_016263831.1 | LysR substrate-binding domain-containing protein | - |
PALA11_RS21790 (PALA11_04328) | 4671222..4672175 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
PALA11_RS21795 (PALA11_04329) | 4672396..4672830 | + | 435 | WP_003116494.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T259635 WP_003111825.1 NZ_CP106680:c4668865-4668500 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6AKP0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1C7BMJ2 |