Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 1567100..1567425 | Replicon | chromosome |
Accession | NZ_CP106671 | ||
Organism | Bacillus subtilis strain SRCM116301 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | N7980_RS08110 | Protein ID | WP_128751232.1 |
Coordinates | 1567246..1567425 (-) | Length | 60 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 1567100..1567322 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7980_RS08065 (1562469) | 1562469..1562780 | + | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
N7980_RS08070 (1562784) | 1562784..1563179 | + | 396 | WP_004398566.1 | DUF3199 family protein | - |
N7980_RS08075 (1563176) | 1563176..1563538 | + | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
N7980_RS08080 (1563535) | 1563535..1564038 | + | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
N7980_RS08085 (1564051) | 1564051..1564488 | + | 438 | WP_003229927.1 | hypothetical protein | - |
N7980_RS08090 (1564485) | 1564485..1564676 | + | 192 | WP_010886574.1 | hypothetical protein | - |
N7980_RS08095 (1564677) | 1564677..1566077 | + | 1401 | WP_003229929.1 | phage tail sheath family protein | - |
N7980_RS08100 (1566080) | 1566080..1566523 | + | 444 | WP_003229930.1 | phage tail tube protein | - |
N7980_RS08105 (1566777) | 1566777..1566866 | - | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
- (1567100) | 1567100..1567322 | + | 223 | NuclAT_0 | - | Antitoxin |
- (1567100) | 1567100..1567322 | + | 223 | NuclAT_0 | - | Antitoxin |
- (1567100) | 1567100..1567322 | + | 223 | NuclAT_0 | - | Antitoxin |
- (1567100) | 1567100..1567322 | + | 223 | NuclAT_0 | - | Antitoxin |
N7980_RS08110 (1567246) | 1567246..1567425 | - | 180 | WP_128751232.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
N7980_RS08115 (1567571) | 1567571..1568020 | + | 450 | WP_032722171.1 | phage portal protein | - |
N7980_RS08120 (1568062) | 1568062..1568199 | + | 138 | WP_021480099.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1537969..1608125 | 70156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6755.19 Da Isoelectric Point: 8.0288
>T259616 WP_128751232.1 NZ_CP106671:c1567425-1567246 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLYMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT259616 NZ_CP106671:1567100-1567322 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|