Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 692424..693078 | Replicon | plasmid pML.8a3 |
Accession | NZ_CP106661 | ||
Organism | Pantoea dispersa strain ML.8a3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N7977_RS22150 | Protein ID | WP_125311245.1 |
Coordinates | 692746..693078 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N7977_RS22145 | Protein ID | WP_125311239.1 |
Coordinates | 692424..692720 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7977_RS22110 (N7977_22110) | 687556..687687 | + | 132 | WP_262258341.1 | hypothetical protein | - |
N7977_RS22115 (N7977_22115) | 687689..688621 | - | 933 | WP_021508860.1 | AraC family transcriptional regulator | - |
N7977_RS22120 (N7977_22120) | 688782..689516 | + | 735 | WP_058758975.1 | SDR family oxidoreductase | - |
N7977_RS22125 (N7977_22125) | 689594..690562 | - | 969 | WP_262258342.1 | magnesium/cobalt transporter CorA | - |
N7977_RS22130 (N7977_22130) | 690659..690979 | - | 321 | WP_021508856.1 | AzlD domain-containing protein | - |
N7977_RS22135 (N7977_22135) | 690969..691643 | - | 675 | WP_058758973.1 | AzlC family ABC transporter permease | - |
N7977_RS22140 (N7977_22140) | 691746..692294 | + | 549 | WP_125311237.1 | XRE family transcriptional regulator | - |
N7977_RS22145 (N7977_22145) | 692424..692720 | - | 297 | WP_125311239.1 | NadS family protein | Antitoxin |
N7977_RS22150 (N7977_22150) | 692746..693078 | - | 333 | WP_125311245.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7977_RS22155 (N7977_22155) | 693273..693794 | + | 522 | WP_031279967.1 | GNAT family N-acetyltransferase | - |
N7977_RS22160 (N7977_22160) | 693791..695191 | - | 1401 | WP_262258619.1 | ATP-binding cassette domain-containing protein | - |
N7977_RS22165 (N7977_22165) | 695191..695967 | - | 777 | WP_262258620.1 | ABC transporter permease subunit | - |
N7977_RS22170 (N7977_22170) | 695970..696905 | - | 936 | WP_262258343.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..742161 | 742161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12611.43 Da Isoelectric Point: 9.7110
>T259613 WP_125311245.1 NZ_CP106661:c693078-692746 [Pantoea dispersa]
IGNYLEFIETRVFSKARKSLLADDNEFQELQVFLLEHHESGATISQTGGCRKIRWSRAGMGKQGGTRIIYYNRLSSGRIY
LLLIYPKNAKDDLNETEKALLKAFTQQINL
IGNYLEFIETRVFSKARKSLLADDNEFQELQVFLLEHHESGATISQTGGCRKIRWSRAGMGKQGGTRIIYYNRLSSGRIY
LLLIYPKNAKDDLNETEKALLKAFTQQINL
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|