Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 622407..623061 | Replicon | plasmid pML.8a3 |
| Accession | NZ_CP106661 | ||
| Organism | Pantoea dispersa strain ML.8a3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N7977_RS21765 | Protein ID | WP_262258314.1 |
| Coordinates | 622407..622778 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A246NDM6 |
| Locus tag | N7977_RS21770 | Protein ID | WP_021508926.1 |
| Coordinates | 622762..623061 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7977_RS21745 (N7977_21745) | 617675..619054 | + | 1380 | WP_262258312.1 | heavy metal sensor histidine kinase | - |
| N7977_RS21750 (N7977_21750) | 619092..619745 | - | 654 | WP_058770319.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| N7977_RS21755 (N7977_21755) | 619850..620851 | - | 1002 | WP_021508931.1 | zinc-binding alcohol dehydrogenase family protein | - |
| N7977_RS21760 (N7977_21760) | 620988..621905 | + | 918 | WP_058759023.1 | LysR family transcriptional regulator | - |
| N7977_RS21765 (N7977_21765) | 622407..622778 | + | 372 | WP_262258314.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7977_RS21770 (N7977_21770) | 622762..623061 | + | 300 | WP_021508926.1 | XRE family transcriptional regulator | Antitoxin |
| N7977_RS21775 (N7977_21775) | 623139..623606 | - | 468 | WP_058759022.1 | hypothetical protein | - |
| N7977_RS21780 (N7977_21780) | 623792..624721 | - | 930 | WP_262258316.1 | ABC transporter substrate-binding protein | - |
| N7977_RS21785 (N7977_21785) | 624731..625465 | - | 735 | WP_262258318.1 | ABC transporter permease | - |
| N7977_RS21790 (N7977_21790) | 625449..626165 | - | 717 | WP_215788040.1 | ABC transporter ATP-binding protein | - |
| N7977_RS21795 (N7977_21795) | 626162..627130 | - | 969 | WP_262258320.1 | HesA/MoeB/ThiF family protein | - |
| N7977_RS21800 (N7977_21800) | 627141..627899 | - | 759 | WP_010615680.1 | thiazole synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | iroN | 1..742161 | 742161 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14397.59 Da Isoelectric Point: 10.1752
>T259612 WP_262258314.1 NZ_CP106661:622407-622778 [Pantoea dispersa]
VWQVEATDRFWKWLQAQDEALRLDVLAALKLLAQDGPHLGRPFVDTLMLSRVPNMKELRVQSKARPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLRIAETEYHYHLNAIGETHNENLG
VWQVEATDRFWKWLQAQDEALRLDVLAALKLLAQDGPHLGRPFVDTLMLSRVPNMKELRVQSKARPIRSFFVFDPRRHAI
VLCAGNKQGKNQKRFYQQMLRIAETEYHYHLNAIGETHNENLG
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|