Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3538431..3539016 | Replicon | chromosome |
Accession | NZ_CP106660 | ||
Organism | Pantoea dispersa strain ML.8a3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U3TYM8 |
Locus tag | N7977_RS16675 | Protein ID | WP_010615566.1 |
Coordinates | 3538717..3539016 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A246NKX1 |
Locus tag | N7977_RS16670 | Protein ID | WP_010615565.1 |
Coordinates | 3538431..3538730 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7977_RS16650 (N7977_16650) | 3534432..3535733 | + | 1302 | WP_058759604.1 | anaerobic C4-dicarboxylate transporter | - |
N7977_RS16655 (N7977_16655) | 3535820..3537517 | + | 1698 | WP_262256482.1 | protein-disulfide reductase DsbD | - |
N7977_RS16660 (N7977_16660) | 3537584..3538162 | + | 579 | WP_021507771.1 | transcriptional regulator | - |
N7977_RS16670 (N7977_16670) | 3538431..3538730 | - | 300 | WP_010615565.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N7977_RS16675 (N7977_16675) | 3538717..3539016 | - | 300 | WP_010615566.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7977_RS16680 (N7977_16680) | 3539488..3539736 | + | 249 | Protein_3247 | LysR family transcriptional regulator | - |
N7977_RS16685 (N7977_16685) | 3539837..3541006 | - | 1170 | WP_021507773.1 | Gfo/Idh/MocA family oxidoreductase | - |
N7977_RS16690 (N7977_16690) | 3541017..3541940 | - | 924 | WP_262256483.1 | sugar phosphate isomerase/epimerase | - |
N7977_RS16695 (N7977_16695) | 3541939..3542109 | + | 171 | WP_262256484.1 | hypothetical protein | - |
N7977_RS16700 (N7977_16700) | 3542139..3543158 | - | 1020 | WP_262256485.1 | LacI family DNA-binding transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11308.01 Da Isoelectric Point: 10.2176
>T259608 WP_010615566.1 NZ_CP106660:c3539016-3538717 [Pantoea dispersa]
MIEDVLASLAVLREFGPTLGRPDVDTLVGSRFSNMKELRVQSNGRAIRAFFAFDPVRRAIVLCAGNKTGTHQRRFYQAMI
KLADREYQQHLEEMNHAKT
MIEDVLASLAVLREFGPTLGRPDVDTLVGSRFSNMKELRVQSNGRAIRAFFAFDPVRRAIVLCAGNKTGTHQRRFYQAMI
KLADREYQQHLEEMNHAKT
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|