Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 40526..41176 | Replicon | chromosome |
Accession | NZ_CP106658 | ||
Organism | Klebsiella michiganensis strain 8BG |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0H3H3K0 |
Locus tag | N7918_RS00195 | Protein ID | WP_014227314.1 |
Coordinates | 40526..40867 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0H3H3Q5 |
Locus tag | N7918_RS00200 | Protein ID | WP_014227313.1 |
Coordinates | 40877..41176 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7918_RS00180 (N7918_00180) | 36518..37837 | + | 1320 | WP_014227316.1 | MFS transporter | - |
N7918_RS00185 (N7918_00185) | 37983..39374 | + | 1392 | WP_004126843.1 | hexose-6-phosphate:phosphate antiporter | - |
N7918_RS00190 (N7918_00190) | 39823..40275 | + | 453 | WP_163461836.1 | DUF1198 domain-containing protein | - |
N7918_RS00195 (N7918_00195) | 40526..40867 | + | 342 | WP_014227314.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7918_RS00200 (N7918_00200) | 40877..41176 | + | 300 | WP_014227313.1 | helix-turn-helix transcriptional regulator | Antitoxin |
N7918_RS00205 (N7918_00205) | 41295..42476 | + | 1182 | WP_014227312.1 | purine ribonucleoside efflux pump NepI | - |
N7918_RS00210 (N7918_00210) | 42509..43318 | - | 810 | WP_004855618.1 | phosphonoacetaldehyde hydrolase | - |
N7918_RS00215 (N7918_00215) | 43328..44431 | - | 1104 | WP_014227310.1 | 2-aminoethylphosphonate--pyruvate transaminase | - |
N7918_RS00220 (N7918_00220) | 44572..45291 | + | 720 | WP_163461838.1 | phosphonate utilization transcriptional regulator PhnR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13110.00 Da Isoelectric Point: 5.7545
>T259589 WP_014227314.1 NZ_CP106658:40526-40867 [Klebsiella michiganensis]
MWDVETTEVFDKWFEAQTEALKEDMLAAMVILSEYGPRLGRPFADTVNDSAFSNMKELRIQHQGRPIRAFFVFDPSRCGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
MWDVETTEVFDKWFEAQTEALKEDMLAAMVILSEYGPRLGRPFADTVNDSAFSNMKELRIQHQGRPIRAFFVFDPSRCGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H3K0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3H3Q5 |