Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
| Location | 3837308..3837905 | Replicon | chromosome |
| Accession | NZ_CP106654 | ||
| Organism | Klebsiella pneumoniae strain KP5076 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A9J6S5A1 |
| Locus tag | N7990_RS19080 | Protein ID | WP_004893639.1 |
| Coordinates | 3837588..3837905 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | R4YH91 |
| Locus tag | N7990_RS19075 | Protein ID | WP_004142561.1 |
| Coordinates | 3837308..3837595 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7990_RS19045 (3833515) | 3833515..3833763 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
| N7990_RS19050 (3833781) | 3833781..3834122 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
| N7990_RS19055 (3834153) | 3834153..3835268 | - | 1116 | WP_074180844.1 | MBL fold metallo-hydrolase | - |
| N7990_RS19060 (3835448) | 3835448..3836029 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
| N7990_RS19065 (3836029) | 3836029..3836397 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
| N7990_RS19070 (3836517) | 3836517..3837170 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
| N7990_RS19075 (3837308) | 3837308..3837595 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N7990_RS19080 (3837588) | 3837588..3837905 | - | 318 | WP_004893639.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7990_RS19085 (3838090) | 3838090..3839133 | - | 1044 | WP_023279204.1 | DUF2157 domain-containing protein | - |
| N7990_RS19090 (3839803) | 3839803..3840669 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
| N7990_RS19095 (3840778) | 3840778..3842205 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12100.35 Da Isoelectric Point: 11.2767
>T259578 WP_004893639.1 NZ_CP106654:c3837905-3837588 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPSIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|