Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 325520..326106 Replicon chromosome
Accession NZ_CP106654
Organism Klebsiella pneumoniae strain KP5076

Toxin (Protein)


Gene name doc Uniprot ID A0A486Q6W0
Locus tag N7990_RS01510 Protein ID WP_020802489.1
Coordinates 325738..326106 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag N7990_RS01505 Protein ID WP_004174006.1
Coordinates 325520..325741 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7990_RS01485 (321677) 321677..322603 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
N7990_RS01490 (322600) 322600..323877 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
N7990_RS01495 (323874) 323874..324641 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
N7990_RS01500 (324643) 324643..325356 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
N7990_RS01505 (325520) 325520..325741 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
N7990_RS01510 (325738) 325738..326106 + 369 WP_020802489.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
N7990_RS01515 (326379) 326379..327695 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
N7990_RS01520 (327802) 327802..328689 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
N7990_RS01525 (328686) 328686..329531 + 846 WP_023328323.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
N7990_RS01530 (329533) 329533..330603 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 322600..331340 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T259570 WP_020802489.1 NZ_CP106654:325738-326106 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT259570 WP_004174006.1 NZ_CP106654:325520-325741 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A486Q6W0

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References