Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 993190..993847 | Replicon | chromosome |
| Accession | NZ_CP104976 | ||
| Organism | Enterobacter sp. 155105 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A1Z3MZ87 |
| Locus tag | N8O08_RS04785 | Protein ID | WP_063408809.1 |
| Coordinates | 993548..993847 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N8O08_RS04780 | Protein ID | WP_214577165.1 |
| Coordinates | 993190..993537 (-) | Length | 116 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8O08_RS04750 (N8O08_04750) | 988604..989206 | - | 603 | WP_223561330.1 | short chain dehydrogenase | - |
| N8O08_RS04755 (N8O08_04755) | 989304..990191 | + | 888 | WP_223561329.1 | LysR family transcriptional regulator | - |
| N8O08_RS04760 (N8O08_04760) | 990212..991393 | + | 1182 | WP_223561328.1 | PLP-dependent aminotransferase family protein | - |
| N8O08_RS04765 (N8O08_04765) | 991500..991919 | - | 420 | WP_223561327.1 | nuclear transport factor 2 family protein | - |
| N8O08_RS04770 (N8O08_04770) | 992017..992748 | + | 732 | WP_223561326.1 | helix-turn-helix transcriptional regulator | - |
| N8O08_RS04775 (N8O08_04775) | 992720..993145 | - | 426 | WP_223561325.1 | nucleoside triphosphatase NudI | - |
| N8O08_RS04780 (N8O08_04780) | 993190..993537 | - | 348 | WP_214577165.1 | HigA family addiction module antitoxin | Antitoxin |
| N8O08_RS04785 (N8O08_04785) | 993548..993847 | - | 300 | WP_063408809.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8O08_RS04790 (N8O08_04790) | 994098..995267 | - | 1170 | WP_086374946.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| N8O08_RS04795 (N8O08_04795) | 995278..997476 | - | 2199 | WP_223561324.1 | type I secretion system permease/ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11707.32 Da Isoelectric Point: 10.0346
>T259547 WP_063408809.1 NZ_CP104976:c993847-993548 [Enterobacter sp. 155105]
MISYFRDQWLEDFFLYGRSSNVIPSNLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGKAEDLYLSPHKYTQHK
MISYFRDQWLEDFFLYGRSSNVIPSNLETALARKLDIIRAATSHRDLRSPPGNMYEALNPPLKGYSSIRVNRQYRLVFRW
TEGKAEDLYLSPHKYTQHK
Download Length: 300 bp
Antitoxin
Download Length: 116 a.a. Molecular weight: 13055.98 Da Isoelectric Point: 7.0134
>AT259547 WP_214577165.1 NZ_CP104976:c993537-993190 [Enterobacter sp. 155105]
MTLQQALRKPTTPGDVLQYEYLEPLNLKISDLAEMLNVHRNTISALVNNNRKLTADMAIKLAKAFDTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVADVMAKRKSGQPDVA
MTLQQALRKPTTPGDVLQYEYLEPLNLKISDLAEMLNVHRNTISALVNNNRKLTADMAIKLAKAFDTTIEFWLNLQLNVD
IWEAQSNSRTQEELSRIKTVADVMAKRKSGQPDVA
Download Length: 348 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|