Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 3704076..3704657 | Replicon | chromosome |
Accession | NZ_CP104973 | ||
Organism | Phyllobacterium zundukense strain A18/3m |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N8E88_RS30605 | Protein ID | WP_262293809.1 |
Coordinates | 3704076..3704360 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N8E88_RS30610 | Protein ID | WP_262293810.1 |
Coordinates | 3704373..3704657 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E88_RS30590 (N8E88_30600) | 3700214..3700750 | - | 537 | WP_262293806.1 | hypothetical protein | - |
N8E88_RS30595 (N8E88_30605) | 3700983..3701615 | - | 633 | WP_262293807.1 | LysE family translocator | - |
N8E88_RS30600 (N8E88_30610) | 3701883..3704030 | + | 2148 | WP_262293808.1 | penicillin-binding protein 1A | - |
N8E88_RS30605 (N8E88_30615) | 3704076..3704360 | + | 285 | WP_262293809.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E88_RS30610 (N8E88_30620) | 3704373..3704657 | + | 285 | WP_262293810.1 | HigA family addiction module antitoxin | Antitoxin |
N8E88_RS30615 (N8E88_30625) | 3704763..3705347 | + | 585 | WP_262293811.1 | DUF1214 domain-containing protein | - |
N8E88_RS30620 (N8E88_30630) | 3705340..3705885 | + | 546 | WP_262293812.1 | hypothetical protein | - |
N8E88_RS30625 (N8E88_30635) | 3705923..3706114 | - | 192 | WP_262293813.1 | hypothetical protein | - |
N8E88_RS30630 (N8E88_30640) | 3706445..3707404 | + | 960 | WP_262293814.1 | DUF2336 domain-containing protein | - |
N8E88_RS30635 (N8E88_30645) | 3707580..3707927 | - | 348 | WP_262293815.1 | DUF1491 family protein | - |
N8E88_RS30640 (N8E88_30650) | 3708069..3708941 | - | 873 | WP_262293816.1 | peptidoglycan-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10914.50 Da Isoelectric Point: 8.0019
>T259545 WP_262293809.1 NZ_CP104973:3704076-3704360 [Phyllobacterium zundukense]
MILTYRDKRTEAFARGEFVREFQGFERQAYKRLEILEAATSLAELRMLPSNRLEALKGDKSGQFSIRINMQWRICFEWPA
SAAGPSDVAIIDYH
MILTYRDKRTEAFARGEFVREFQGFERQAYKRLEILEAATSLAELRMLPSNRLEALKGDKSGQFSIRINMQWRICFEWPA
SAAGPSDVAIIDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|