Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2053024..2053684 | Replicon | chromosome |
| Accession | NZ_CP104925 | ||
| Organism | Klebsiella pasteurii strain AHM8C130-1I | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N5863_RS09605 | Protein ID | WP_087829044.1 |
| Coordinates | 2053024..2053377 (+) | Length | 118 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N5863_RS09610 | Protein ID | WP_087829043.1 |
| Coordinates | 2053382..2053684 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5863_RS09580 (N5863_09580) | 2048407..2049174 | - | 768 | WP_004122251.1 | molybdopterin-dependent oxidoreductase | - |
| N5863_RS09585 (N5863_09585) | 2049164..2049772 | - | 609 | WP_112166277.1 | cytochrome b/b6 domain-containing protein | - |
| N5863_RS09590 (N5863_09590) | 2049787..2050413 | - | 627 | WP_112166276.1 | hypothetical protein | - |
| N5863_RS09595 (N5863_09595) | 2050553..2051224 | + | 672 | WP_004122240.1 | heavy metal response regulator transcription factor | - |
| N5863_RS09600 (N5863_09600) | 2051221..2052639 | + | 1419 | WP_004122238.1 | heavy metal sensor histidine kinase | - |
| N5863_RS09605 (N5863_09605) | 2053024..2053377 | + | 354 | WP_087829044.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5863_RS09610 (N5863_09610) | 2053382..2053684 | + | 303 | WP_087829043.1 | XRE family transcriptional regulator | Antitoxin |
| N5863_RS09620 (N5863_09620) | 2054087..2055544 | + | 1458 | WP_123829136.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| N5863_RS09630 (N5863_09630) | 2056568..2058022 | - | 1455 | WP_004122234.1 | AMP nucleosidase | - |
| N5863_RS09635 (N5863_09635) | 2058171..2058410 | - | 240 | WP_284658974.1 | histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13535.43 Da Isoelectric Point: 9.4800
>T259508 WP_087829044.1 NZ_CP104925:2053024-2053377 [Klebsiella pasteurii]
VWMIKTTDTFERWFTSLNDTDRASVLAALLVLREKGPGLSRPYADTLRGSRYSNMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVSNEKRFYDEILPVADREYTNWLNTLKEKE
VWMIKTTDTFERWFTSLNDTDRASVLAALLVLREKGPGLSRPYADTLRGSRYSNMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVSNEKRFYDEILPVADREYTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|