Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 764054..764748 | Replicon | chromosome |
| Accession | NZ_CP104920 | ||
| Organism | Dickeya solani strain RNS 05.1.2A | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | RS71_RS03510 | Protein ID | WP_057082976.1 |
| Coordinates | 764054..764458 (-) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | G7LPQ3 |
| Locus tag | RS71_RS03515 | Protein ID | WP_009111694.1 |
| Coordinates | 764455..764748 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RS71_RS03490 | 759443..759664 | - | 222 | WP_022634593.1 | acyl carrier protein | - |
| RS71_RS03495 | 759683..761116 | - | 1434 | WP_022634594.1 | AMP-binding protein | - |
| RS71_RS03500 | 761113..762231 | - | 1119 | WP_057082977.1 | cytochrome c552 | - |
| RS71_RS03505 | 762361..763500 | - | 1140 | WP_022634597.1 | D-alanyl-lipoteichoic acid biosynthesis protein DltD | - |
| RS71_RS03510 | 764054..764458 | - | 405 | WP_057082976.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| RS71_RS03515 | 764455..764748 | - | 294 | WP_009111694.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| RS71_RS03520 | 764973..766166 | + | 1194 | WP_057083010.1 | SIR2 family protein | - |
| RS71_RS03525 | 766171..768036 | + | 1866 | WP_072143108.1 | ATP-binding protein | - |
| RS71_RS03530 | 768045..768254 | + | 210 | WP_072143107.1 | KTSC domain-containing protein | - |
| RS71_RS03535 | 768663..768779 | - | 117 | WP_263083506.1 | type 4 pilus major pilin | - |
| RS71_RS03540 | 768970..769179 | + | 210 | WP_263083309.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15500.84 Da Isoelectric Point: 7.1284
>T259492 WP_057082976.1 NZ_CP104920:c764458-764054 [Dickeya solani]
MSIRIFKSALIRQQLSQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLIKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
MSIRIFKSALIRQQLSQQELDDLAADFLSYKKDGVLPDTFGRDAPYDDDRTYPLIKEEQVAHIHLADADAPFPKFLRQFK
RTSDQAHLVYCQGAMDPDAYLLIIILKPEAHKMARNNNHMHKIGMMAEAFRMKH
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|