Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1127433..1128017 | Replicon | chromosome |
Accession | NZ_CP104917 | ||
Organism | Avibacterium paragallinarum strain AP-2 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | N8E87_RS05675 | Protein ID | WP_264246545.1 |
Coordinates | 1127739..1128017 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N8E87_RS05670 | Protein ID | WP_110478985.1 |
Coordinates | 1127433..1127729 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E87_RS05655 (N8E87_05655) | 1123346..1123825 | + | 480 | WP_017806582.1 | leucine-responsive transcriptional regulator Lrp | - |
N8E87_RS05660 (N8E87_05660) | 1123827..1126679 | + | 2853 | WP_264246541.1 | DNA translocase FtsK 4TM domain-containing protein | - |
N8E87_RS05665 (N8E87_05665) | 1126761..1127381 | + | 621 | WP_264246543.1 | outer membrane lipoprotein chaperone LolA | - |
N8E87_RS05670 (N8E87_05670) | 1127433..1127729 | - | 297 | WP_110478985.1 | HigA family addiction module antitoxin | Antitoxin |
N8E87_RS05675 (N8E87_05675) | 1127739..1128017 | - | 279 | WP_264246545.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E87_RS05680 (N8E87_05680) | 1128170..1129519 | + | 1350 | WP_264246547.1 | replication-associated recombination protein A | - |
N8E87_RS05685 (N8E87_05685) | 1129593..1130882 | + | 1290 | WP_115249899.1 | serine--tRNA ligase | - |
N8E87_RS05690 (N8E87_05690) | 1131086..1132162 | + | 1077 | WP_264246549.1 | peptide chain release factor 1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10851.51 Da Isoelectric Point: 9.2249
>T259490 WP_264246545.1 NZ_CP104917:c1128017-1127739 [Avibacterium paragallinarum]
MITHFTCKDTQAFFEGQRIRRFIPFEKVAMRKLQQLNAATELNFLRIPPGNHLEMLTGDRKGQYSIRINDQWRICFTWLN
GHAADVAIVDYH
MITHFTCKDTQAFFEGQRIRRFIPFEKVAMRKLQQLNAATELNFLRIPPGNHLEMLTGDRKGQYSIRINDQWRICFTWLN
GHAADVAIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|