Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 568800..569469 | Replicon | chromosome |
| Accession | NZ_CP104917 | ||
| Organism | Avibacterium paragallinarum strain AP-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | N8E87_RS02800 | Protein ID | WP_264245847.1 |
| Coordinates | 568800..569165 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N8E87_RS02805 | Protein ID | WP_017807009.1 |
| Coordinates | 569167..569469 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E87_RS02780 (N8E87_02780) | 563919..564647 | + | 729 | WP_264245841.1 | 30S ribosomal protein S2 | - |
| N8E87_RS02785 (N8E87_02785) | 564779..565624 | + | 846 | WP_264245842.1 | translation elongation factor Ts | - |
| N8E87_RS02790 (N8E87_02790) | 565919..567508 | - | 1590 | WP_264245844.1 | peptide chain release factor 3 | - |
| N8E87_RS02795 (N8E87_02795) | 567690..568550 | + | 861 | WP_264245845.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| N8E87_RS02800 (N8E87_02800) | 568800..569165 | + | 366 | WP_264245847.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8E87_RS02805 (N8E87_02805) | 569167..569469 | + | 303 | WP_017807009.1 | XRE family transcriptional regulator | Antitoxin |
| N8E87_RS02810 (N8E87_02810) | 569581..570420 | + | 840 | WP_264245849.1 | SDR family oxidoreductase | - |
| N8E87_RS02815 (N8E87_02815) | 570511..571851 | + | 1341 | WP_017807007.1 | argininosuccinate synthase | - |
| N8E87_RS02820 (N8E87_02820) | 571968..572843 | + | 876 | WP_264245851.1 | VirK/YbjX family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14097.38 Da Isoelectric Point: 6.3716
>T259486 WP_264245847.1 NZ_CP104917:568800-569165 [Avibacterium paragallinarum]
MKQEWKVILQDPLLNWLETLAEDDLLKVYAALALLSTEGPQLGRPYADTIQGSKYTNLKELRVQSKLSVFRLFYIFDPIR
QAIVLCGGDKKGKKEKLFYKEMITLAEQTYDNYLSEFLKEQ
MKQEWKVILQDPLLNWLETLAEDDLLKVYAALALLSTEGPQLGRPYADTIQGSKYTNLKELRVQSKLSVFRLFYIFDPIR
QAIVLCGGDKKGKKEKLFYKEMITLAEQTYDNYLSEFLKEQ
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|