Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1383251..1383835 | Replicon | chromosome |
| Accession | NZ_CP104914 | ||
| Organism | Avibacterium paragallinarum strain AG21-0333 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | - |
| Locus tag | N8E86_RS06480 | Protein ID | WP_264255269.1 |
| Coordinates | 1383251..1383529 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N8E86_RS06485 | Protein ID | WP_110478985.1 |
| Coordinates | 1383539..1383835 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8E86_RS06465 (N8E86_06465) | 1379100..1380182 | - | 1083 | WP_264255264.1 | peptide chain release factor 1 | - |
| N8E86_RS06470 (N8E86_06470) | 1380386..1381675 | - | 1290 | WP_264255265.1 | serine--tRNA ligase | - |
| N8E86_RS06475 (N8E86_06475) | 1381749..1383098 | - | 1350 | WP_264255267.1 | replication-associated recombination protein A | - |
| N8E86_RS06480 (N8E86_06480) | 1383251..1383529 | + | 279 | WP_264255269.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N8E86_RS06485 (N8E86_06485) | 1383539..1383835 | + | 297 | WP_110478985.1 | HigA family addiction module antitoxin | Antitoxin |
| N8E86_RS06490 (N8E86_06490) | 1383887..1384507 | - | 621 | WP_264255271.1 | outer membrane lipoprotein chaperone LolA | - |
| N8E86_RS06495 (N8E86_06495) | 1384589..1387441 | - | 2853 | WP_264255273.1 | DNA translocase FtsK 4TM domain-containing protein | - |
| N8E86_RS06500 (N8E86_06500) | 1387443..1387922 | - | 480 | WP_017806582.1 | leucine-responsive transcriptional regulator Lrp | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10833.45 Da Isoelectric Point: 7.9348
>T259478 WP_264255269.1 NZ_CP104914:1383251-1383529 [Avibacterium paragallinarum]
MITHFTCKDTQAFFEGQRIHRFIPFEKVAMRKLQQLDAATELNFLRIPPGNHLEMLTGDRKGQYSIRINDQWRICFTWLN
GHAADVAIVDYH
MITHFTCKDTQAFFEGQRIHRFIPFEKVAMRKLQQLDAATELNFLRIPPGNHLEMLTGDRKGQYSIRINDQWRICFTWLN
GHAADVAIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|