Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 844274..844943 | Replicon | chromosome |
Accession | NZ_CP104914 | ||
Organism | Avibacterium paragallinarum strain AG21-0333 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A380X0Q1 |
Locus tag | N8E86_RS04195 | Protein ID | WP_017807010.1 |
Coordinates | 844274..844639 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N8E86_RS04200 | Protein ID | WP_017807009.1 |
Coordinates | 844641..844943 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8E86_RS04175 (N8E86_04175) | 839364..840092 | + | 729 | WP_264256736.1 | 30S ribosomal protein S2 | - |
N8E86_RS04180 (N8E86_04180) | 840224..841069 | + | 846 | WP_264256738.1 | translation elongation factor Ts | - |
N8E86_RS04185 (N8E86_04185) | 841394..842983 | - | 1590 | WP_264256741.1 | peptide chain release factor 3 | - |
N8E86_RS04190 (N8E86_04190) | 843165..844025 | + | 861 | WP_264256742.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
N8E86_RS04195 (N8E86_04195) | 844274..844639 | + | 366 | WP_017807010.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N8E86_RS04200 (N8E86_04200) | 844641..844943 | + | 303 | WP_017807009.1 | XRE family transcriptional regulator | Antitoxin |
N8E86_RS04205 (N8E86_04205) | 845055..845894 | + | 840 | WP_264256743.1 | SDR family oxidoreductase | - |
N8E86_RS04210 (N8E86_04210) | 845963..847303 | + | 1341 | WP_264256744.1 | argininosuccinate synthase | - |
N8E86_RS04215 (N8E86_04215) | 847419..848294 | + | 876 | WP_264256745.1 | VirK/YbjX family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14098.33 Da Isoelectric Point: 4.9436
>T259477 WP_017807010.1 NZ_CP104914:844274-844639 [Avibacterium paragallinarum]
MKQEWEVILQDPLLNWLETLAEDDLLKVYAALALLSTEGPQLGRPYADTIQGSKYTNLKELRVQSKLSVFRLFYIFDPIR
QAIVLCGGDKKGKKEKLFYKEMITLAEQTYDNYLSEFLKEQ
MKQEWEVILQDPLLNWLETLAEDDLLKVYAALALLSTEGPQLGRPYADTIQGSKYTNLKELRVQSKLSVFRLFYIFDPIR
QAIVLCGGDKKGKKEKLFYKEMITLAEQTYDNYLSEFLKEQ
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|