Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 796990..797598 | Replicon | chromosome |
Accession | NZ_CP104913 | ||
Organism | Pseudomonas aeruginosa strain PA-AUTBAM |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | N2X48_RS03755 | Protein ID | WP_003114156.1 |
Coordinates | 797251..797598 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | N2X48_RS03750 | Protein ID | WP_003114155.1 |
Coordinates | 796990..797241 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N2X48_RS03730 (N2X48_03730) | 792637..792993 | + | 357 | WP_003114150.1 | DUF2523 family protein | - |
N2X48_RS03735 (N2X48_03735) | 792997..794271 | + | 1275 | WP_010895520.1 | zonular occludens toxin family protein | - |
N2X48_RS03740 (N2X48_03740) | 794501..795793 | + | 1293 | WP_003115206.1 | hypothetical protein | - |
N2X48_RS03745 (N2X48_03745) | 795793..796776 | + | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
N2X48_RS03750 (N2X48_03750) | 796990..797241 | + | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
N2X48_RS03755 (N2X48_03755) | 797251..797598 | + | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N2X48_RS03765 (N2X48_03765) | 797925..798827 | - | 903 | WP_003114157.1 | (R)-3-hydroxydecanoyl-ACP:CoA transacylase | - |
N2X48_RS03770 (N2X48_03770) | 799279..800016 | - | 738 | WP_003114158.1 | murein L,D-transpeptidase catalytic domain family protein | - |
N2X48_RS03775 (N2X48_03775) | 800096..801139 | - | 1044 | WP_003098363.1 | L,D-transpeptidase | - |
N2X48_RS03780 (N2X48_03780) | 801275..801967 | - | 693 | WP_003114159.1 | 16S rRNA pseudouridine(516) synthase | - |
N2X48_RS03785 (N2X48_03785) | 801967..802239 | - | 273 | WP_010895521.1 | cysteine-rich CWC family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 783009..797598 | 14589 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T259472 WP_003114156.1 NZ_CP104913:797251-797598 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |