Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 54675..55333 | Replicon | plasmid punamed1 |
Accession | NZ_CP104909 | ||
Organism | Acinetobacter baumannii strain YZM-0314 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N7297_RS19040 | Protein ID | WP_000312250.1 |
Coordinates | 54974..55333 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N7297_RS19035 | Protein ID | WP_001096429.1 |
Coordinates | 54675..54974 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7297_RS18990 (N7297_18990) | 49708..49965 | + | 258 | WP_000834292.1 | hypothetical protein | - |
N7297_RS18995 (N7297_18995) | 49970..50542 | + | 573 | WP_000429351.1 | hypothetical protein | - |
N7297_RS19000 (N7297_19000) | 50518..50697 | + | 180 | WP_002081921.1 | hypothetical protein | - |
N7297_RS19005 (N7297_19005) | 50714..51343 | + | 630 | WP_002081923.1 | hypothetical protein | - |
N7297_RS19010 (N7297_19010) | 51383..51892 | + | 510 | WP_001043199.1 | hypothetical protein | - |
N7297_RS19015 (N7297_19015) | 51973..52527 | + | 555 | WP_000790085.1 | hypothetical protein | - |
N7297_RS19020 (N7297_19020) | 52577..53113 | + | 537 | WP_000731981.1 | hypothetical protein | - |
N7297_RS19025 (N7297_19025) | 53736..54218 | + | 483 | WP_001052677.1 | hypothetical protein | - |
N7297_RS19030 (N7297_19030) | 54311..54574 | - | 264 | WP_000110863.1 | hypothetical protein | - |
N7297_RS19035 (N7297_19035) | 54675..54974 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
N7297_RS19040 (N7297_19040) | 54974..55333 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7297_RS19045 (N7297_19045) | 55534..56100 | + | 567 | WP_041171756.1 | hypothetical protein | - |
N7297_RS19050 (N7297_19050) | 56149..56331 | + | 183 | WP_000373385.1 | hypothetical protein | - |
N7297_RS19055 (N7297_19055) | 56398..57096 | + | 699 | WP_000873190.1 | hypothetical protein | - |
N7297_RS19060 (N7297_19060) | 57235..57618 | + | 384 | WP_000654349.1 | hypothetical protein | - |
N7297_RS19065 (N7297_19065) | 57685..58443 | + | 759 | WP_001053129.1 | hypothetical protein | - |
N7297_RS19070 (N7297_19070) | 59513..59827 | + | 315 | WP_000708714.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..71276 | 71276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T259467 WP_000312250.1 NZ_CP104909:c55333-54974 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|