Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1885947..1886513 | Replicon | chromosome |
Accession | NZ_CP104882 | ||
Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a |
Toxin (Protein)
Gene name | higB | Uniprot ID | X2JU35 |
Locus tag | N7761_RS09375 | Protein ID | WP_005543444.1 |
Coordinates | 1886235..1886513 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | N7761_RS09370 | Protein ID | WP_005543446.1 |
Coordinates | 1885947..1886219 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7761_RS09345 (N7761_09345) | 1882487..1882753 | - | 267 | WP_005543457.1 | oxaloacetate decarboxylase subunit gamma | - |
N7761_RS09350 (N7761_09350) | 1883114..1883305 | + | 192 | WP_005553960.1 | hypothetical protein | - |
N7761_RS09355 (N7761_09355) | 1883280..1883657 | + | 378 | WP_005543455.1 | hypothetical protein | - |
N7761_RS09360 (N7761_09360) | 1883778..1884053 | - | 276 | WP_005561117.1 | hydrogenase maturation factor HybG | - |
N7761_RS09365 (N7761_09365) | 1884508..1885938 | - | 1431 | WP_005566276.1 | bifunctional indole-3-glycerol-phosphate synthase TrpC/phosphoribosylanthranilate isomerase TrpF | - |
N7761_RS09370 (N7761_09370) | 1885947..1886219 | - | 273 | WP_005543446.1 | HigA family addiction module antitoxin | Antitoxin |
N7761_RS09375 (N7761_09375) | 1886235..1886513 | - | 279 | WP_005543444.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7761_RS09380 (N7761_09380) | 1886608..1887609 | - | 1002 | WP_014167798.1 | anthranilate phosphoribosyltransferase | - |
N7761_RS09385 (N7761_09385) | 1887621..1888013 | - | 393 | WP_005543439.1 | tautomerase family protein | - |
N7761_RS09390 (N7761_09390) | 1888087..1888677 | - | 591 | WP_005572120.1 | aminodeoxychorismate/anthranilate synthase component II | - |
N7761_RS09395 (N7761_09395) | 1888688..1890235 | - | 1548 | WP_005572118.1 | anthranilate synthase component 1 | - |
N7761_RS09400 (N7761_09400) | 1890403..1890957 | - | 555 | WP_005543432.1 | HAD family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10490.95 Da Isoelectric Point: 9.5983
>T259458 WP_005543444.1 NZ_CP104882:c1886513-1886235 [Aggregatibacter actinomycetemcomitans]
MILSFKHKGLEQFFKTGSTAGIQAKHAKKLNLQLATLNNAETPLAMSVPSWNLHKLKGDLQEHWAVTVNGNWRLTFKFEN
GHAEVVDYQDYH
MILSFKHKGLEQFFKTGSTAGIQAKHAKKLNLQLATLNNAETPLAMSVPSWNLHKLKGDLQEHWAVTVNGNWRLTFKFEN
GHAEVVDYQDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|