Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 11228..11874 | Replicon | chromosome |
| Accession | NZ_CP104882 | ||
| Organism | Aggregatibacter actinomycetemcomitans strain IDHaas10a | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | X2JQ23 |
| Locus tag | N7761_RS00060 | Protein ID | WP_005555126.1 |
| Coordinates | 11524..11874 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | X2JT85 |
| Locus tag | N7761_RS00055 | Protein ID | WP_005540827.1 |
| Coordinates | 11228..11527 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7761_RS00045 (N7761_00045) | 7830..8057 | - | 228 | WP_005567423.1 | hypothetical protein | - |
| N7761_RS00050 (N7761_00050) | 8259..11192 | + | 2934 | WP_014167733.1 | bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase | - |
| N7761_RS00055 (N7761_00055) | 11228..11527 | - | 300 | WP_005540827.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| N7761_RS00060 (N7761_00060) | 11524..11874 | - | 351 | WP_005555126.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7761_RS00065 (N7761_00065) | 12062..13645 | - | 1584 | WP_005567417.1 | peptide chain release factor 3 | - |
| N7761_RS00070 (N7761_00070) | 14002..14829 | + | 828 | WP_005540818.1 | hypothetical protein | - |
| N7761_RS00075 (N7761_00075) | 14924..16261 | + | 1338 | WP_005567415.1 | argininosuccinate synthase | - |
| N7761_RS00080 (N7761_00080) | 16451..16696 | + | 246 | WP_005540815.1 | YgjV family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13518.64 Da Isoelectric Point: 9.9664
>T259452 WP_005555126.1 NZ_CP104882:c11874-11524 [Aggregatibacter actinomycetemcomitans]
MWAVILTERFETWLNQQPIKTQECVLANLVRLEHFGPNLARPYVDSVAGSIHSNMKELRVQHSGRAIRLFFAFDPKRRAI
VLCGGDKGNDKRFYRTMIRIADQELNHYLATMEQTK
MWAVILTERFETWLNQQPIKTQECVLANLVRLEHFGPNLARPYVDSVAGSIHSNMKELRVQHSGRAIRLFFAFDPKRRAI
VLCGGDKGNDKRFYRTMIRIADQELNHYLATMEQTK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|