Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2557900..2558225 | Replicon | chromosome |
| Accession | NZ_CP104878 | ||
| Organism | Bacillus subtilis strain 4ZT | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | P54373 |
| Locus tag | N8A75_RS13975 | Protein ID | WP_004398662.1 |
| Coordinates | 2557900..2558079 (+) | Length | 60 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2558003..2558225 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A75_RS13965 (2557126) | 2557126..2557263 | - | 138 | WP_021480099.1 | hypothetical protein | - |
| N8A75_RS13970 (2557305) | 2557305..2557754 | - | 450 | WP_032722171.1 | phage portal protein | - |
| N8A75_RS13975 (2557900) | 2557900..2558079 | + | 180 | WP_004398662.1 | type I toxin-antitoxin system toxin TxpA | Toxin |
| - (2558003) | 2558003..2558225 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2558003) | 2558003..2558225 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2558003) | 2558003..2558225 | - | 223 | NuclAT_0 | - | Antitoxin |
| - (2558003) | 2558003..2558225 | - | 223 | NuclAT_0 | - | Antitoxin |
| N8A75_RS13980 (2558459) | 2558459..2558548 | + | 90 | WP_075058862.1 | type I toxin-antitoxin system toxin BsrH | - |
| N8A75_RS13985 (2558802) | 2558802..2559245 | - | 444 | WP_003229930.1 | phage tail tube protein | - |
| N8A75_RS13990 (2559248) | 2559248..2560648 | - | 1401 | WP_262090974.1 | phage tail sheath family protein | - |
| N8A75_RS13995 (2560649) | 2560649..2560840 | - | 192 | WP_010886574.1 | hypothetical protein | - |
| N8A75_RS14000 (2560837) | 2560837..2561274 | - | 438 | WP_003229927.1 | hypothetical protein | - |
| N8A75_RS14005 (2561287) | 2561287..2561790 | - | 504 | WP_003246050.1 | HK97 gp10 family phage protein | - |
| N8A75_RS14010 (2561787) | 2561787..2562149 | - | 363 | WP_003229925.1 | YqbH/XkdH family protein | - |
| N8A75_RS14015 (2562146) | 2562146..2562541 | - | 396 | WP_004398566.1 | DUF3199 family protein | - |
| N8A75_RS14020 (2562545) | 2562545..2562856 | - | 312 | WP_003229923.1 | YqbF domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2525147..2601919 | 76772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6739.19 Da Isoelectric Point: 8.0370
>T259448 WP_004398662.1 NZ_CP104878:2557900-2558079 [Bacillus subtilis]
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
MSTYESLMVMIGFANLIGGIMTWVISLLTLLFMLRKKDTHPIYITVKEKCLHEDPPIKG
Download Length: 180 bp
Antitoxin
Download Length: 223 bp
>AT259448 NZ_CP104878:c2558225-2558003 [Bacillus subtilis]
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
CAAGCAAAAGTATTGCAACTACTGGCGTAAGCTTATAGTTGGTACCACATTACCACATTACCACTTGTTAATGTGTGTTA
CTTTCATGAGAAATGCTAAAATATAAAAGCCAGAGTGTGGCAGCACTCTAGCTTTTAAAAAAGAAACTACCCTTTAATAG
GAGGGTCCTCGTGTAGACACTTTTCCTTTACAGTAATGTAAATAGGATGAGTGTCTTTTTTTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
