Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | yonT-SR6/- |
| Location | 1836458..1836675 | Replicon | chromosome |
| Accession | NZ_CP104878 | ||
| Organism | Bacillus subtilis strain 4ZT | ||
Toxin (Protein)
| Gene name | yonT | Uniprot ID | - |
| Locus tag | N8A75_RS09600 | Protein ID | WP_019712271.1 |
| Coordinates | 1836458..1836634 (+) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SR6 | ||
| Locus tag | - | ||
| Coordinates | 1836575..1836675 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A75_RS09585 | 1832242..1833144 | - | 903 | WP_262091555.1 | GIY-YIG nuclease family protein | - |
| N8A75_RS09590 | 1833329..1835203 | - | 1875 | Protein_1833 | hypothetical protein | - |
| N8A75_RS09595 | 1835243..1835437 | - | 195 | WP_004399291.1 | hypothetical protein | - |
| - | 1836417..1836516 | - | 100 | NuclAT_1 | - | - |
| - | 1836417..1836516 | - | 100 | NuclAT_1 | - | - |
| - | 1836417..1836516 | - | 100 | NuclAT_1 | - | - |
| - | 1836417..1836516 | - | 100 | NuclAT_1 | - | - |
| N8A75_RS09600 | 1836458..1836634 | + | 177 | WP_019712271.1 | hypothetical protein | Toxin |
| - | 1836575..1836675 | - | 101 | - | - | Antitoxin |
| N8A75_RS09605 | 1836653..1836904 | + | 252 | WP_262091556.1 | hypothetical protein | - |
| N8A75_RS09610 | 1836950..1837111 | + | 162 | WP_262091557.1 | hypothetical protein | - |
| N8A75_RS09615 | 1837222..1838454 | + | 1233 | WP_041336993.1 | hypothetical protein | - |
| N8A75_RS09620 | 1838783..1839288 | + | 506 | Protein_1839 | hypothetical protein | - |
| N8A75_RS09625 | 1839432..1839686 | + | 255 | WP_262091559.1 | hypothetical protein | - |
| N8A75_RS09630 | 1839860..1840066 | + | 207 | WP_262091561.1 | hypothetical protein | - |
| N8A75_RS09635 | 1840105..1840278 | + | 174 | WP_262091563.1 | hypothetical protein | - |
| N8A75_RS09640 | 1840271..1840528 | + | 258 | WP_213420342.1 | hypothetical protein | - |
| N8A75_RS09645 | 1840525..1840734 | + | 210 | WP_069322700.1 | hypothetical protein | - |
| N8A75_RS09650 | 1840769..1840942 | + | 174 | WP_196219421.1 | hypothetical protein | - |
| N8A75_RS09655 | 1840972..1841310 | + | 339 | WP_262091565.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1754691..1922395 | 167704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6864.42 Da Isoelectric Point: 12.8833
>T259444 WP_019712271.1 NZ_CP104878:1836458-1836634 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 101 bp
>AT259444 NZ_CP104878:c1836675-1836575 [Bacillus subtilis]
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
TAGGAACTAAAGGAGAAGTTCATTCCCCTTTAGCTTAGCTCTCATCGGCGTATACGTTGGCGTTGTCTCTTTGGTCGGAG
CCGCTTGCGTATACGCTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|