Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | yonT-as-bsrH/- |
Location | 1836417..1836634 | Replicon | chromosome |
Accession | NZ_CP104878 | ||
Organism | Bacillus subtilis strain 4ZT |
Toxin (Protein)
Gene name | yonT | Uniprot ID | - |
Locus tag | N8A75_RS09600 | Protein ID | WP_019712271.1 |
Coordinates | 1836458..1836634 (+) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | as-bsrH | ||
Locus tag | - | ||
Coordinates | 1836417..1836516 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N8A75_RS09585 (1832242) | 1832242..1833144 | - | 903 | WP_262091555.1 | GIY-YIG nuclease family protein | - |
N8A75_RS09590 (1833329) | 1833329..1835203 | - | 1875 | Protein_1833 | hypothetical protein | - |
N8A75_RS09595 (1835243) | 1835243..1835437 | - | 195 | WP_004399291.1 | hypothetical protein | - |
- (1836417) | 1836417..1836516 | - | 100 | NuclAT_1 | - | Antitoxin |
- (1836417) | 1836417..1836516 | - | 100 | NuclAT_1 | - | Antitoxin |
- (1836417) | 1836417..1836516 | - | 100 | NuclAT_1 | - | Antitoxin |
- (1836417) | 1836417..1836516 | - | 100 | NuclAT_1 | - | Antitoxin |
N8A75_RS09600 (1836458) | 1836458..1836634 | + | 177 | WP_019712271.1 | hypothetical protein | Toxin |
N8A75_RS09605 (1836653) | 1836653..1836904 | + | 252 | WP_262091556.1 | hypothetical protein | - |
N8A75_RS09610 (1836950) | 1836950..1837111 | + | 162 | WP_262091557.1 | hypothetical protein | - |
N8A75_RS09615 (1837222) | 1837222..1838454 | + | 1233 | WP_041336993.1 | hypothetical protein | - |
N8A75_RS09620 (1838783) | 1838783..1839288 | + | 506 | Protein_1839 | hypothetical protein | - |
N8A75_RS09625 (1839432) | 1839432..1839686 | + | 255 | WP_262091559.1 | hypothetical protein | - |
N8A75_RS09630 (1839860) | 1839860..1840066 | + | 207 | WP_262091561.1 | hypothetical protein | - |
N8A75_RS09635 (1840105) | 1840105..1840278 | + | 174 | WP_262091563.1 | hypothetical protein | - |
N8A75_RS09640 (1840271) | 1840271..1840528 | + | 258 | WP_213420342.1 | hypothetical protein | - |
N8A75_RS09645 (1840525) | 1840525..1840734 | + | 210 | WP_069322700.1 | hypothetical protein | - |
N8A75_RS09650 (1840769) | 1840769..1840942 | + | 174 | WP_196219421.1 | hypothetical protein | - |
N8A75_RS09655 (1840972) | 1840972..1841310 | + | 339 | WP_262091565.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1754691..1922395 | 167704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6864.42 Da Isoelectric Point: 12.8833
>T259439 WP_019712271.1 NZ_CP104878:1836458-1836634 [Bacillus subtilis]
VLEKVGIIVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
VLEKVGIIVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
Download Length: 177 bp
Antitoxin
Download Length: 100 bp
>AT259439 NZ_CP104878:c1836516-1836417 [Bacillus subtilis]
ATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTAT
GACTCTATTATAACATAATT
ATTGTAAGAACCGTTAAAGATATGAGGAAAGCAACTATGATACCCACTTTCTCAAGCACTATGTACACCTCCTTTCCTAT
GACTCTATTATAACATAATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|