Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 6041631..6042226 | Replicon | chromosome |
| Accession | NZ_CP104870 | ||
| Organism | Pseudomonas aeruginosa strain PALA9 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | PALA9_RS28145 | Protein ID | WP_003117425.1 |
| Coordinates | 6041948..6042226 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA9_RS28140 | Protein ID | WP_003099268.1 |
| Coordinates | 6041631..6041936 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA9_RS28110 (PALA9_05567) | 6037084..6037374 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| PALA9_RS28115 (PALA9_05568) | 6037586..6037858 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| PALA9_RS28120 (PALA9_05569) | 6037968..6038234 | + | 267 | WP_016852153.1 | hypothetical protein | - |
| PALA9_RS28125 (PALA9_05570) | 6038366..6039202 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
| PALA9_RS28130 (PALA9_05571) | 6039177..6040715 | + | 1539 | WP_023082696.1 | GNAT family N-acetyltransferase | - |
| PALA9_RS28135 | 6040727..6041254 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
| PALA9_RS28140 (PALA9_05572) | 6041631..6041936 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA9_RS28145 | 6041948..6042226 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA9_RS28150 | 6042279..6042407 | - | 129 | Protein_5566 | integrase | - |
| PALA9_RS28155 (PALA9_05573) | 6042555..6044783 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| PALA9_RS28160 (PALA9_05574) | 6044853..6045500 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA9_RS28165 (PALA9_05575) | 6045562..6046800 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T259435 WP_003117425.1 NZ_CP104870:c6042226-6041948 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|