Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5643303..5643898 | Replicon | chromosome |
| Accession | NZ_CP104869 | ||
| Organism | Pseudomonas aeruginosa strain PALA8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA8_RS26225 | Protein ID | WP_003113526.1 |
| Coordinates | 5643620..5643898 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA8_RS26220 | Protein ID | WP_003133769.1 |
| Coordinates | 5643303..5643608 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA8_RS26185 | 5638325..5638615 | - | 291 | WP_031757220.1 | DUF5447 family protein | - |
| PALA8_RS26190 (PALA8_05216) | 5638791..5639063 | - | 273 | WP_004352675.1 | hypothetical protein | - |
| PALA8_RS26195 | 5639175..5639447 | + | 273 | WP_071543058.1 | DNA-binding protein | - |
| PALA8_RS26200 (PALA8_05217) | 5639503..5639838 | + | 336 | WP_023094905.1 | hypothetical protein | - |
| PALA8_RS26205 | 5639932..5640522 | + | 591 | WP_071536478.1 | SLATT domain-containing protein | - |
| PALA8_RS26210 (PALA8_05218) | 5640519..5641784 | + | 1266 | WP_023094906.1 | nucleotidyltransferase | - |
| PALA8_RS26215 (PALA8_05219) | 5641868..5642860 | - | 993 | WP_003133766.1 | hypothetical protein | - |
| PALA8_RS26220 (PALA8_05220) | 5643303..5643608 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA8_RS26225 | 5643620..5643898 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA8_RS26230 | 5643951..5644079 | - | 129 | Protein_5184 | integrase | - |
| PALA8_RS26235 (PALA8_05221) | 5644227..5646455 | + | 2229 | WP_003133778.1 | TonB-dependent receptor | - |
| PALA8_RS26240 (PALA8_05222) | 5646526..5647173 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA8_RS26245 (PALA8_05223) | 5647235..5648473 | - | 1239 | WP_003095023.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T259427 WP_003113526.1 NZ_CP104869:c5643898-5643620 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|