Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 5009878..5010559 | Replicon | chromosome |
| Accession | NZ_CP104869 | ||
| Organism | Pseudomonas aeruginosa strain PALA8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PALA8_RS23255 | Protein ID | WP_015503432.1 |
| Coordinates | 5010194..5010559 (-) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA8_RS23250 | Protein ID | WP_004364117.1 |
| Coordinates | 5009878..5010201 (-) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA8_RS23220 (PALA8_04625) | 5005654..5006231 | + | 578 | Protein_4596 | plasmid pRiA4b ORF-3 family protein | - |
| PALA8_RS23225 | 5006597..5006992 | - | 396 | Protein_4597 | hypothetical protein | - |
| PALA8_RS23235 (PALA8_04629) | 5008252..5009256 | - | 1005 | Protein_4599 | tyrosine-type recombinase/integrase | - |
| PALA8_RS23240 (PALA8_04631) | 5009256..5009648 | - | 393 | Protein_4600 | hypothetical protein | - |
| PALA8_RS23245 | 5009643..5009762 | + | 120 | Protein_4601 | IS5/IS1182 family transposase | - |
| PALA8_RS23250 (PALA8_04632) | 5009878..5010201 | - | 324 | WP_004364117.1 | XRE family transcriptional regulator | Antitoxin |
| PALA8_RS23255 | 5010194..5010559 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA8_RS23260 | 5010823..5011062 | - | 240 | WP_044069615.1 | hypothetical protein | - |
| PALA8_RS23265 (PALA8_04633) | 5011269..5011541 | + | 273 | WP_004364121.1 | hypothetical protein | - |
| PALA8_RS23270 (PALA8_04634) | 5011572..5011997 | - | 426 | WP_003116492.1 | VOC family protein | - |
| PALA8_RS23275 (PALA8_04635) | 5012098..5012982 | + | 885 | WP_004364122.1 | LysR substrate-binding domain-containing protein | - |
| PALA8_RS23280 (PALA8_04636) | 5012955..5013908 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
| PALA8_RS23285 (PALA8_04637) | 5014129..5014563 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4976435..5011997 | 35562 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T259425 WP_015503432.1 NZ_CP104869:c5010559-5010194 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|