Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5546667..5547262 | Replicon | chromosome |
| Accession | NZ_CP104868 | ||
| Organism | Pseudomonas aeruginosa strain PALA7 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | PALA7_RS25790 | Protein ID | WP_003113526.1 |
| Coordinates | 5546984..5547262 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PALA7_RS25785 | Protein ID | WP_003099268.1 |
| Coordinates | 5546667..5546972 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA7_RS25750 (PALA7_05094) | 5541806..5542654 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| PALA7_RS25760 (PALA7_05096) | 5542821..5543762 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| PALA7_RS25765 (PALA7_05097) | 5543879..5544493 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| PALA7_RS25770 (PALA7_05098) | 5544535..5545119 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| PALA7_RS25775 (PALA7_05099) | 5545160..5546260 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| PALA7_RS25785 (PALA7_05101) | 5546667..5546972 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
| PALA7_RS25790 | 5546984..5547262 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA7_RS25795 | 5547315..5547443 | - | 129 | Protein_5097 | integrase | - |
| PALA7_RS25800 (PALA7_05102) | 5547591..5549819 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| PALA7_RS25805 (PALA7_05103) | 5549889..5550536 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| PALA7_RS25810 (PALA7_05104) | 5550598..5551836 | - | 1239 | WP_003099263.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T259418 WP_003113526.1 NZ_CP104868:c5547262-5546984 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|