Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) prlF-yhaV (relBE)/YhaV-PrlF
Location 2704476..2705251 Replicon chromosome
Accession NZ_CP104866
Organism Pseudomonas aeruginosa strain PALA4

Toxin (Protein)


Gene name yhaV Uniprot ID V6ADY6
Locus tag PALA4_RS12730 Protein ID WP_009518525.1
Coordinates 2704793..2705251 (+) Length 153 a.a.

Antitoxin (Protein)


Gene name prlF Uniprot ID V6AEP7
Locus tag PALA4_RS12725 Protein ID WP_023098543.1
Coordinates 2704476..2704793 (+) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA4_RS12695 (PALA4_02517) 2699960..2700382 + 423 WP_003090234.1 MerR family DNA-binding protein -
PALA4_RS12700 2700617..2700949 - 333 WP_228380005.1 redox-sensitive transcriptional activator SoxR -
PALA4_RS12705 (PALA4_02518) 2700900..2701097 + 198 WP_023108461.1 hypothetical protein -
PALA4_RS12710 (PALA4_02519) 2701171..2702082 + 912 WP_003090227.1 NAD(P)H-binding protein -
PALA4_RS12715 2702156..2702377 + 222 WP_099459023.1 MerR family DNA-binding transcriptional regulator -
PALA4_RS12720 (PALA4_02520) 2702359..2704176 - 1818 WP_023108460.1 MobH family relaxase -
PALA4_RS12725 (PALA4_02521) 2704476..2704793 + 318 WP_023098543.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
PALA4_RS12730 (PALA4_02522) 2704793..2705251 + 459 WP_009518525.1 type II toxin-antitoxin system YhaV family toxin Toxin
PALA4_RS12735 (PALA4_02523) 2705278..2705655 + 378 WP_009518524.1 DUF3742 family protein -
PALA4_RS12740 (PALA4_02524) 2705671..2707188 - 1518 WP_023108459.1 conjugal transfer protein TraG N-terminal domain-containing protein -
PALA4_RS12745 (PALA4_02525) 2707203..2707562 - 360 WP_023108458.1 hypothetical protein -
PALA4_RS12750 (PALA4_02526) 2707559..2708953 - 1395 WP_009518521.1 integrating conjugative element protein -
PALA4_RS12755 (PALA4_02527) 2708963..2709910 - 948 WP_023108457.1 TIGR03756 family integrating conjugative element protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 2648114..2772559 124445


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin endonuclease, YhaV

(8-144)

Antitoxin

PrlF antitoxin

(8-100)


Sequences

Toxin        


Download         Length: 153 a.a.        Molecular weight: 17660.02 Da        Isoelectric Point: 10.1848

>T259401 WP_009518525.1 NZ_CP104866:2704793-2705251 [Pseudomonas aeruginosa]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE

Download         Length: 459 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 11170.72 Da        Isoelectric Point: 4.7182

>AT259401 WP_023098543.1 NZ_CP104866:2704476-2704793 [Pseudomonas aeruginosa]
MPAIHEVATLTSKGQITLPKPIRQALGVDAGGKLAFDLRGSEVVVTRVDAEHEDPAIGAFLSLLARDIEAGRNVRGLPED
LARAMLEHAGHGVNLDEEIDGKVEL

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V6ADY6

Antitoxin

Source ID Structure
AlphaFold DB V6AEP7

References