Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5181153..5181748 | Replicon | chromosome |
Accession | NZ_CP104865 | ||
Organism | Pseudomonas aeruginosa strain PALA2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A241XLJ5 |
Locus tag | PALA2_RS24195 | Protein ID | WP_003117425.1 |
Coordinates | 5181470..5181748 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PALA2_RS24190 | Protein ID | WP_003113527.1 |
Coordinates | 5181153..5181458 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA2_RS24155 (PALA2_04801) | 5176293..5177141 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
PALA2_RS24165 (PALA2_04803) | 5177308..5178249 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
PALA2_RS24170 (PALA2_04804) | 5178366..5178980 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
PALA2_RS24175 (PALA2_04805) | 5179022..5179606 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
PALA2_RS24180 (PALA2_04806) | 5179647..5180747 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
PALA2_RS24190 (PALA2_04808) | 5181153..5181458 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
PALA2_RS24195 | 5181470..5181748 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA2_RS24200 | 5181801..5181929 | - | 129 | Protein_4777 | integrase | - |
PALA2_RS24205 (PALA2_04809) | 5182077..5184305 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
PALA2_RS24210 (PALA2_04810) | 5184375..5185022 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
PALA2_RS24215 (PALA2_04811) | 5185084..5186322 | - | 1239 | WP_003117424.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T259395 WP_003117425.1 NZ_CP104865:c5181748-5181470 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|