Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 5083317..5083980 | Replicon | chromosome |
Accession | NZ_CP104861 | ||
Organism | Pseudomonas fragi strain D12 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | N7D90_RS23305 | Protein ID | WP_261742515.1 |
Coordinates | 5083615..5083980 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | N7D90_RS23300 | Protein ID | WP_261740178.1 |
Coordinates | 5083317..5083622 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7D90_RS23285 (N7D90_23285) | 5079469..5080809 | + | 1341 | WP_261740175.1 | GntP family permease | - |
N7D90_RS23290 (N7D90_23290) | 5080853..5082199 | + | 1347 | WP_261740176.1 | D-serine ammonia-lyase | - |
N7D90_RS23295 (N7D90_23295) | 5082333..5083283 | + | 951 | WP_261740177.1 | DNA-binding transcriptional regulator DsdC | - |
N7D90_RS23300 (N7D90_23300) | 5083317..5083622 | - | 306 | WP_261740178.1 | helix-turn-helix domain-containing protein | Antitoxin |
N7D90_RS23305 (N7D90_23305) | 5083615..5083980 | - | 366 | WP_261742515.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7D90_RS23310 (N7D90_23310) | 5084198..5085481 | - | 1284 | WP_261740179.1 | OprD family porin | - |
N7D90_RS23315 (N7D90_23315) | 5085712..5086407 | - | 696 | WP_261740180.1 | DsbA family protein | - |
N7D90_RS23320 (N7D90_23320) | 5086791..5087897 | - | 1107 | WP_261740181.1 | agmatine deiminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13988.80 Da Isoelectric Point: 6.3302
>T259387 WP_261742515.1 NZ_CP104861:c5083980-5083615 [Pseudomonas fragi]
MDWDVEYTDEFGNWWESLGEKEQVSVAASVKLLGLLGPGLRFPHCSDIKGSRHGNLRELRVQHAGRPYRVLYAFDPRRCA
LLLIGGDKTGHDRWYEEYVPFAQKLYDLHLETLLEEGRKNG
MDWDVEYTDEFGNWWESLGEKEQVSVAASVKLLGLLGPGLRFPHCSDIKGSRHGNLRELRVQHAGRPYRVLYAFDPRRCA
LLLIGGDKTGHDRWYEEYVPFAQKLYDLHLETLLEEGRKNG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|