Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1934055..1934657 | Replicon | chromosome |
| Accession | NZ_CP104858 | ||
| Organism | Salmonella sp. 3C | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | M7S4R6 |
| Locus tag | N7E69_RS09220 | Protein ID | WP_001159635.1 |
| Coordinates | 1934055..1934366 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7E69_RS09225 | Protein ID | WP_000362050.1 |
| Coordinates | 1934367..1934657 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E69_RS09185 (1929168) | 1929168..1929767 | + | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| N7E69_RS09190 (1929761) | 1929761..1930633 | + | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| N7E69_RS09195 (1930630) | 1930630..1931067 | + | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| N7E69_RS09200 (1931112) | 1931112..1932053 | + | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| N7E69_RS09205 (1932068) | 1932068..1932514 | - | 447 | WP_001259012.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| N7E69_RS09210 (1932511) | 1932511..1932822 | - | 312 | WP_000558169.1 | type II toxin-antitoxin system HigB family toxin | - |
| N7E69_RS09215 (1932908) | 1932908..1933837 | - | 930 | WP_001127708.1 | alpha/beta hydrolase | - |
| N7E69_RS09220 (1934055) | 1934055..1934366 | + | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| N7E69_RS09225 (1934367) | 1934367..1934657 | + | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| N7E69_RS09230 (1934704) | 1934704..1935633 | - | 930 | WP_000027737.1 | formate dehydrogenase accessory protein FdhE | - |
| N7E69_RS09235 (1935630) | 1935630..1936265 | - | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| N7E69_RS09240 (1936262) | 1936262..1937164 | - | 903 | WP_000331367.1 | formate dehydrogenase subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T259368 WP_001159635.1 NZ_CP104858:1934055-1934366 [Salmonella sp. 3C]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|