Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 60473..60712 Replicon plasmid pHN4E2-NDM5
Accession NZ_CP104852
Organism Escherichia coli strain GYX208DH4E-2

Toxin (Protein)


Gene name srnB Uniprot ID A0A762TWR7
Locus tag N6H16_RS23845 Protein ID WP_023144756.1
Coordinates 60473..60607 (-) Length 45 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 60652..60712 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N6H16_RS23820 (56174) 56174..57031 - 858 WP_000130640.1 incFII family plasmid replication initiator RepA -
N6H16_RS23825 (57024) 57024..57098 - 75 WP_031943482.1 RepA leader peptide Tap -
N6H16_RS23830 (57460) 57460..59001 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
N6H16_RS23835 (59016) 59016..59762 + 747 WP_053906593.1 IS21-like element ISEc12 family helper ATPase IstB -
N6H16_RS23840 (59922) 59922..60176 - 255 WP_000083850.1 replication regulatory protein RepA -
N6H16_RS23845 (60473) 60473..60607 - 135 WP_023144756.1 Hok/Gef family protein Toxin
- (60652) 60652..60712 + 61 NuclAT_0 - Antitoxin
- (60652) 60652..60712 + 61 NuclAT_0 - Antitoxin
- (60652) 60652..60712 + 61 NuclAT_0 - Antitoxin
- (60652) 60652..60712 + 61 NuclAT_0 - Antitoxin
N6H16_RS23850 (60679) 60679..60965 - 287 Protein_77 DUF2726 domain-containing protein -
N6H16_RS23855 (61478) 61478..61690 - 213 WP_013023861.1 hypothetical protein -
N6H16_RS23860 (61821) 61821..62381 - 561 WP_000139341.1 fertility inhibition protein FinO -
N6H16_RS23865 (62436) 62436..63182 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -
N6H16_RS23870 (63202) 63202..65024 - 1823 Protein_81 conjugative transfer relaxase/helicase TraI -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(B) / sul1 / qacE / aadA2 / dfrA12 / blaNDM-5 / aadA5 / blaTEM-1B / aac(3)-IId / mph(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaOXA-1 / aac(6')-Ib-cr - 1..99713 99713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-44)


Sequences

Toxin        


Download         Length: 45 a.a.        Molecular weight: 4896.90 Da        Isoelectric Point: 7.7209

>T259338 WP_023144756.1 NZ_CP104852:c60607-60473 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Download         Length: 135 bp

Antitoxin


Download         Length: 61 bp

>AT259338 NZ_CP104852:60652-60712 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A762TWR7

Antitoxin

Download structure file

References