Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 656170..656969 | Replicon | chromosome |
Accession | NZ_CP104851 | ||
Organism | Escherichia coli strain GYX208DH4E-2 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | N6H16_RS03215 | Protein ID | WP_000347251.1 |
Coordinates | 656170..656634 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | N6H16_RS03220 | Protein ID | WP_001307405.1 |
Coordinates | 656634..656969 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H16_RS03185 (651171) | 651171..651605 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
N6H16_RS03190 (651623) | 651623..652501 | - | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
N6H16_RS03195 (652491) | 652491..653270 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
N6H16_RS03200 (653281) | 653281..653754 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
N6H16_RS03205 (653777) | 653777..655057 | - | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
N6H16_RS03210 (655306) | 655306..656115 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
N6H16_RS03215 (656170) | 656170..656634 | - | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
N6H16_RS03220 (656634) | 656634..656969 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
N6H16_RS03225 (657118) | 657118..658689 | - | 1572 | WP_001273761.1 | galactarate dehydratase | - |
N6H16_RS03230 (659064) | 659064..660398 | + | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
N6H16_RS03235 (660414) | 660414..661184 | + | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T259321 WP_000347251.1 NZ_CP104851:c656634-656170 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |