Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 57473..57715 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP104849 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | N7218_RS25245 | Protein ID | WP_001372321.1 |
| Coordinates | 57590..57715 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 57473..57513 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS25220 (52668) | 52668..54626 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
| N7218_RS25225 (54681) | 54681..55115 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| N7218_RS25230 (55112) | 55112..55874 | + | 763 | Protein_80 | plasmid SOS inhibition protein A | - |
| - (55843) | 55843..56029 | + | 187 | NuclAT_0 | - | - |
| - (55843) | 55843..56029 | + | 187 | NuclAT_0 | - | - |
| - (55843) | 55843..56029 | + | 187 | NuclAT_0 | - | - |
| - (55843) | 55843..56029 | + | 187 | NuclAT_0 | - | - |
| N7218_RS25235 (56077) | 56077..57446 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - (57473) | 57473..57513 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (57473) | 57473..57513 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (57473) | 57473..57513 | + | 41 | NuclAT_1 | - | Antitoxin |
| - (57473) | 57473..57513 | + | 41 | NuclAT_1 | - | Antitoxin |
| N7218_RS25240 (57499) | 57499..57648 | + | 150 | Protein_82 | plasmid maintenance protein Mok | - |
| N7218_RS25245 (57590) | 57590..57715 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| N7218_RS25250 (57935) | 57935..58165 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| N7218_RS25255 (58163) | 58163..58336 | - | 174 | Protein_85 | hypothetical protein | - |
| N7218_RS25260 (58406) | 58406..58612 | + | 207 | WP_024261895.1 | hypothetical protein | - |
| N7218_RS25265 (58637) | 58637..58924 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| N7218_RS25270 (59043) | 59043..59864 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| N7218_RS25275 (60161) | 60161..60763 | - | 603 | WP_260654181.1 | transglycosylase SLT domain-containing protein | - |
| N7218_RS25280 (61094) | 61094..61477 | + | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| N7218_RS25285 (61611) | 61611..62288 | + | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| N7218_RS25290 (62376) | 62376..62603 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | - | 1..85007 | 85007 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T259315 WP_001372321.1 NZ_CP104849:57590-57715 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT259315 NZ_CP104849:57473-57513 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
