Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4854013..4854615 | Replicon | chromosome |
| Accession | NZ_CP104848 | ||
| Organism | Escherichia coli strain DFK.1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | N7218_RS23815 | Protein ID | WP_000897302.1 |
| Coordinates | 4854304..4854615 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | N7218_RS23810 | Protein ID | WP_000356397.1 |
| Coordinates | 4854013..4854303 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7218_RS23780 (4849320) | 4849320..4850249 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| N7218_RS23785 (4850431) | 4850431..4850673 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| N7218_RS23790 (4850963) | 4850963..4851811 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| N7218_RS23795 (4851836) | 4851836..4852576 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| N7218_RS23800 (4852761) | 4852761..4852979 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| N7218_RS23805 (4853376) | 4853376..4853654 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| N7218_RS23810 (4854013) | 4854013..4854303 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| N7218_RS23815 (4854304) | 4854304..4854615 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| N7218_RS23820 (4854844) | 4854844..4855752 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| N7218_RS23825 (4855816) | 4855816..4856757 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| N7218_RS23830 (4856802) | 4856802..4857239 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| N7218_RS23835 (4857236) | 4857236..4858108 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| N7218_RS23840 (4858102) | 4858102..4858701 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T259312 WP_000897302.1 NZ_CP104848:c4854615-4854304 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|