Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2455739..2455960 Replicon chromosome
Accession NZ_CP104848
Organism Escherichia coli strain DFK.1

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag N7218_RS12290 Protein ID WP_001531632.1
Coordinates 2455739..2455846 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2455894..2455960 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7218_RS12265 (2451583) 2451583..2452665 + 1083 WP_000804726.1 peptide chain release factor 1 -
N7218_RS12270 (2452665) 2452665..2453498 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
N7218_RS12275 (2453495) 2453495..2453887 + 393 WP_000200375.1 invasion regulator SirB2 -
N7218_RS12280 (2453891) 2453891..2454700 + 810 WP_001257044.1 invasion regulator SirB1 -
N7218_RS12285 (2454736) 2454736..2455590 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
N7218_RS12290 (2455739) 2455739..2455846 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2455896) 2455896..2455959 + 64 NuclAT_12 - -
- (2455896) 2455896..2455959 + 64 NuclAT_12 - -
- (2455896) 2455896..2455959 + 64 NuclAT_12 - -
- (2455896) 2455896..2455959 + 64 NuclAT_12 - -
- (2455896) 2455896..2455959 + 64 NuclAT_13 - -
- (2455896) 2455896..2455959 + 64 NuclAT_13 - -
- (2455896) 2455896..2455959 + 64 NuclAT_13 - -
- (2455896) 2455896..2455959 + 64 NuclAT_13 - -
- (2455896) 2455896..2455959 + 64 NuclAT_14 - -
- (2455896) 2455896..2455959 + 64 NuclAT_14 - -
- (2455896) 2455896..2455959 + 64 NuclAT_14 - -
- (2455896) 2455896..2455959 + 64 NuclAT_14 - -
- (2455896) 2455896..2455959 + 64 NuclAT_15 - -
- (2455896) 2455896..2455959 + 64 NuclAT_15 - -
- (2455896) 2455896..2455959 + 64 NuclAT_15 - -
- (2455896) 2455896..2455959 + 64 NuclAT_15 - -
- (2455896) 2455896..2455959 + 64 NuclAT_16 - -
- (2455896) 2455896..2455959 + 64 NuclAT_16 - -
- (2455896) 2455896..2455959 + 64 NuclAT_16 - -
- (2455896) 2455896..2455959 + 64 NuclAT_16 - -
- (2455896) 2455896..2455959 + 64 NuclAT_17 - -
- (2455896) 2455896..2455959 + 64 NuclAT_17 - -
- (2455896) 2455896..2455959 + 64 NuclAT_17 - -
- (2455896) 2455896..2455959 + 64 NuclAT_17 - -
- (2455894) 2455894..2455960 + 67 NuclAT_10 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_10 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_10 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_10 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_5 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_5 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_5 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_5 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_6 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_6 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_6 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_6 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_7 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_7 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_7 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_7 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_8 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_8 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_8 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_8 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_9 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_9 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_9 - Antitoxin
- (2455894) 2455894..2455960 + 67 NuclAT_9 - Antitoxin
- (2455896) 2455896..2455961 + 66 NuclAT_18 - -
- (2455896) 2455896..2455961 + 66 NuclAT_18 - -
- (2455896) 2455896..2455961 + 66 NuclAT_18 - -
- (2455896) 2455896..2455961 + 66 NuclAT_18 - -
- (2455896) 2455896..2455961 + 66 NuclAT_19 - -
- (2455896) 2455896..2455961 + 66 NuclAT_19 - -
- (2455896) 2455896..2455961 + 66 NuclAT_19 - -
- (2455896) 2455896..2455961 + 66 NuclAT_19 - -
- (2455896) 2455896..2455961 + 66 NuclAT_20 - -
- (2455896) 2455896..2455961 + 66 NuclAT_20 - -
- (2455896) 2455896..2455961 + 66 NuclAT_20 - -
- (2455896) 2455896..2455961 + 66 NuclAT_20 - -
- (2455896) 2455896..2455961 + 66 NuclAT_21 - -
- (2455896) 2455896..2455961 + 66 NuclAT_21 - -
- (2455896) 2455896..2455961 + 66 NuclAT_21 - -
- (2455896) 2455896..2455961 + 66 NuclAT_21 - -
- (2455896) 2455896..2455961 + 66 NuclAT_22 - -
- (2455896) 2455896..2455961 + 66 NuclAT_22 - -
- (2455896) 2455896..2455961 + 66 NuclAT_22 - -
- (2455896) 2455896..2455961 + 66 NuclAT_22 - -
- (2455896) 2455896..2455961 + 66 NuclAT_23 - -
- (2455896) 2455896..2455961 + 66 NuclAT_23 - -
- (2455896) 2455896..2455961 + 66 NuclAT_23 - -
- (2455896) 2455896..2455961 + 66 NuclAT_23 - -
N7218_RS12295 (2456251) 2456251..2457351 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
N7218_RS12300 (2457621) 2457621..2457860 + 240 WP_000120702.1 putative cation transport regulator ChaB -
N7218_RS12305 (2458009) 2458009..2458704 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
N7218_RS12310 (2458748) 2458748..2459101 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
N7218_RS12315 (2459286) 2459286..2460680 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T259298 WP_001531632.1 NZ_CP104848:c2455846-2455739 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT259298 NZ_CP104848:2455894-2455960 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References